BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30638 (785 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 27 0.50 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 6.1 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 23 8.1 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 23 8.1 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 23 8.1 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 23 8.1 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 8.1 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 27.5 bits (58), Expect = 0.50 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -3 Query: 783 TNINRIKKKMNLLNS*FGLLFKR 715 TNINRIK KM LL F FKR Sbjct: 333 TNINRIKGKMLLLQRRFSEDFKR 355 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 6.1 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 166 YFICDLLCDNNIFYQLYFVTFIDYLRDKQTFNCV 267 YFI +C N I ++ +D L D + V Sbjct: 694 YFIILFICGNYILLNVFLAIAVDNLADADSLTTV 727 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 61 AVRVQLLARRRYIHATLDITKLLCY 85 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 61 AVRVQLLARRRYIHATLDITKLLCY 85 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 459 ATLVTYVRTRAYSHATSDVTYLLFF 533 A V + R Y HAT D+T LL + Sbjct: 72 AVRVQLLARRRYIHATLDITKLLCY 96 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.4 bits (48), Expect = 8.1 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +1 Query: 562 CPCPCHCY 585 CP PC CY Sbjct: 667 CPAPCRCY 674 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 719,833 Number of Sequences: 2352 Number of extensions: 13301 Number of successful extensions: 104 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -