BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30633 (832 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 27 3.3 SPAC17C9.12 |||MSP domain|Schizosaccharomyces pombe|chr 1|||Manual 27 4.3 SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple ca... 26 7.5 SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces pomb... 26 7.5 SPAC644.13c |||Rab GTPase binding |Schizosaccharomyces pombe|chr... 26 7.5 SPCC70.04c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||... 25 10.0 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 27.1 bits (57), Expect = 3.3 Identities = 13/48 (27%), Positives = 28/48 (58%) Frame = +3 Query: 45 EAPAPSTLGSLQNLNMDSMLRHTFVPDYSVKAIAELYYLTIKRSMYLA 188 E P+ L + N++ +++ + F +YS+KA L+ + IK++ +A Sbjct: 1762 EHPSSIALHFVYNVDKENIYSYKFFSEYSIKASYWLHSIGIKKNDVVA 1809 >SPAC17C9.12 |||MSP domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 319 Score = 26.6 bits (56), Expect = 4.3 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 300 VRENEESPKSQFVPSSASPRT-NSTFKS 380 V ENE PK Q VP++ SP N+ +S Sbjct: 220 VAENEPYPKPQSVPTTTSPNNENNALRS 247 >SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple cancers-1 homolog 2|Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 25.8 bits (54), Expect = 7.5 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 6/67 (8%) Frame = -1 Query: 802 YLVKVLT--RIL*RRRLYSN---QSVLTYQ*KYFVQMHRLPP-LIIDDSSNKSLLSVFLK 641 +++ +L+ RI LY+N Q + + + F ++HR LII +S NK L + K Sbjct: 277 FIILILSDARIKENTHLYANGEGQHIKNHLLELFKKLHRTQDFLIIAESINKFLSNPLKK 336 Query: 640 NYQIVSY 620 QI+++ Sbjct: 337 ERQIITF 343 >SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 25.8 bits (54), Expect = 7.5 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 317 LFVLPDLLDPVAFAQQLIHFWFDLLI-SAALVEHPLLHERGA 195 +F++PDL D V + L +FDL AA+V+ L GA Sbjct: 247 IFIVPDLYDRVYVEKILDILFFDLHFGKAAIVQESLCTSFGA 288 >SPAC644.13c |||Rab GTPase binding |Schizosaccharomyces pombe|chr 1|||Manual Length = 225 Score = 25.8 bits (54), Expect = 7.5 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -2 Query: 531 LIQNLTRSERQILLIYFVVVFYFGVAMFL 445 ++QN S +++L +Y + +FYF +A + Sbjct: 195 VLQNSNLSNKKLLAVYPLFLFYFSLAWII 223 >SPCC70.04c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 244 Score = 25.4 bits (53), Expect = 10.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 285 DRIEEVRENEESPKSQFVPSSASPRTN 365 D IE +RE ESPKSQ PS + N Sbjct: 24 DVIETMRETNESPKSQ-NPSEEATTVN 49 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,208,212 Number of Sequences: 5004 Number of extensions: 62590 Number of successful extensions: 158 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 408446760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -