BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30631 (470 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 122 1e-28 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 122 1e-28 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 121 3e-28 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 120 4e-28 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 120 8e-28 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 119 1e-27 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 119 1e-27 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 118 2e-27 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 105 1e-23 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 58 3e-09 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 55 3e-08 01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931... 50 1e-06 12_02_1282 + 27528159-27529148,27529549-27529614 48 4e-06 02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980... 46 1e-05 08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160... 44 6e-05 04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182... 40 0.001 08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981... 31 0.62 01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238... 30 0.82 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 122 bits (294), Expect = 1e-28 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 122 bits (294), Expect = 1e-28 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 121 bits (291), Expect = 3e-28 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKC Sbjct: 320 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPAIVHRKC 379 Query: 285 F 283 F Sbjct: 380 F 380 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 120 bits (290), Expect = 4e-28 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKC Sbjct: 314 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 373 Query: 285 F 283 F Sbjct: 374 F 374 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 120 bits (288), Expect = 8e-28 Identities = 53/61 (86%), Positives = 58/61 (95%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 119 bits (287), Expect = 1e-27 Identities = 53/61 (86%), Positives = 58/61 (95%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI +LAPS++K+K+IAPPERKYSVWIGGSILASLSTFQQMWISK EYDESGPGIVH KC Sbjct: 316 KEITSLAPSSMKVKVIAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPGIVHMKC 375 Query: 285 F 283 F Sbjct: 376 F 376 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 119 bits (287), Expect = 1e-27 Identities = 53/61 (86%), Positives = 57/61 (93%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAP ++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPGIVH KC Sbjct: 316 KEITALAPGSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKC 375 Query: 285 F 283 F Sbjct: 376 F 376 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 118 bits (284), Expect = 2e-27 Identities = 52/61 (85%), Positives = 58/61 (95%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWIS+ EY+ESGP IVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISRAEYEESGPAIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 105 bits (253), Expect = 1e-23 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 14/75 (18%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQ--------------QMWISKE 328 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQ QMWISK Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQVNLTPTLYEVARMQMWISKG 376 Query: 327 EYDESGPGIVHRKCF 283 EYDESGP IVHRKCF Sbjct: 377 EYDESGPAIVHRKCF 391 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 58.4 bits (135), Expect = 3e-09 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = -3 Query: 453 ALAPSTIKIKIIAPPE-RKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 283 A+ PS +K P +YS W+GG+ILA + Q ++K +YDE+GP IVH+KCF Sbjct: 341 AICPSLVKPPEYMPENLARYSAWLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 398 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 55.2 bits (127), Expect = 3e-08 Identities = 25/51 (49%), Positives = 36/51 (70%), Gaps = 3/51 (5%) Frame = -3 Query: 468 QKEIXALAPSTIKIKIIAPP---ERKYSVWIGGSILASLSTFQQMWISKEE 325 +KE+ + ++K++A ER++SVWIGGSILASL +FQQMW SK + Sbjct: 419 EKEVLEESSGNTRVKVLASGNSVERRFSVWIGGSILASLGSFQQMWFSKAD 469 >01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744, 9318837-9318921,9319005-9319068,9319139-9319340, 9319808-9320502 Length = 429 Score = 49.6 bits (113), Expect = 1e-06 Identities = 24/62 (38%), Positives = 34/62 (54%) Frame = -3 Query: 468 QKEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRK 289 +KE+ L P ++KIIA + W GGS+LA F+ M I+K EY+E G R+ Sbjct: 367 EKELRPLVPDDYQVKIIAQEDPILGAWRGGSLLAHRPDFESMCITKSEYEEMGSMRCRRR 426 Query: 288 CF 283 F Sbjct: 427 FF 428 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 48.0 bits (109), Expect = 4e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -3 Query: 372 LASLSTFQQMWISKEEYDESGPGIVHRKCF 283 LA S +MWI+K EYDESGP IVHRKCF Sbjct: 322 LAPSSMKIKMWIAKAEYDESGPSIVHRKCF 351 >02_04_0473 + 23197294-23197340,23197443-23197680,23197792-23198016, 23198616-23198762,23198827-23198961,23199415-23199507, 23199925-23200044,23200303-23200413,23200486-23200611, 23200731-23200829,23201024-23201104 Length = 473 Score = 46.4 bits (105), Expect = 1e-05 Identities = 18/45 (40%), Positives = 31/45 (68%) Frame = -3 Query: 435 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGI 301 I++ +++ P ++Y+VW GGS+LAS + F + +K EY+E G I Sbjct: 418 IEVNVVSHPIQRYAVWFGGSVLASTAEFYEACHTKAEYEEYGASI 462 >08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328, 1604403-1604513,1604989-1605108,1605665-1605757, 1606024-1606157,1606503-1606530,1606821-1607075, 1607167-1607401,1608147-1608193 Length = 440 Score = 44.0 bits (99), Expect = 6e-05 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 435 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGI 301 +++ ++A P + Y+ W GGS+ AS F + +KEEY+E G I Sbjct: 385 VEVNVVAHPIQSYAAWFGGSVAASNPEFYESCHTKEEYEEHGASI 429 >04_04_1515 + 34117383-34117732,34117833-34117918,34118227-34118297, 34118457-34118524,34118692-34118753,34119010-34119107, 34119545-34119626,34119935-34120077,34120233-34120381, 34120461-34120594,34120714-34120832,34120926-34121014, 34121398-34121515 Length = 522 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 7/65 (10%) Frame = -3 Query: 468 QKEIXALAPSTIK--IKIIAPPERKYSVWIGGSILASLSTFQQMW-ISKEEYDE----SG 310 +KE+ L P+ I I++I PP S W G +++++STF + W I K+++ + +G Sbjct: 418 EKELRELLPAHISEGIRVIPPPFGTDSAWFGAKMISNVSTFTEAWCIKKKQFRQKTRRNG 477 Query: 309 PGIVH 295 P V+ Sbjct: 478 PSFVN 482 >08_02_0441 - 17196352-17196536,17196780-17196906,17198018-17198101, 17198282-17198348,17198575-17198633,17199211-17199336, 17199406-17199474,17199545-17199653,17199692-17199760, 17199876-17199979,17200518-17200567,17200696-17200774, 17200867-17200938,17201083-17201217,17201311-17201421, 17202088-17202129 Length = 495 Score = 30.7 bits (66), Expect = 0.62 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = -3 Query: 435 IKIKIIAPPERKYSVWIGGSILASL 361 ++++I PP RK+ V++GG++LA + Sbjct: 366 LRLRIEDPPRRKHMVYLGGAVLAGI 390 >01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104, 2389338-2389390,2390496-2390968,2391090-2391432, 2391793-2391911,2392081-2392512,2392657-2392747, 2392833-2392942,2393681-2393875,2394581-2394622, 2395144-2395268,2395856-2395926,2396047-2396147 Length = 1042 Score = 30.3 bits (65), Expect = 0.82 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = -3 Query: 459 IXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRK 289 I P +K++ + W G + A+ S F + S +Y E G + HRK Sbjct: 646 IRQFRPYLSPLKLVRAADPLIDAWRGAAAFAASSKFGRHTFSLADYREHGENLFHRK 702 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,986,515 Number of Sequences: 37544 Number of extensions: 214501 Number of successful extensions: 570 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 955200320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -