BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30631 (470 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A... 122 1e-28 At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A... 122 1e-28 At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S... 121 2e-28 At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A... 120 7e-28 At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A... 120 7e-28 At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497... 120 7e-28 At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496... 120 7e-28 At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A... 120 7e-28 At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara... 106 7e-24 At2g42100.1 68415.m05205 actin, putative very strong similarity ... 105 1e-23 At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac... 98 3e-21 At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A... 79 2e-15 At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id... 75 3e-14 At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica... 60 1e-09 At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i... 46 1e-05 At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica... 43 9e-05 At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i... 42 3e-04 At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) ... 30 0.91 At5g43500.2 68418.m05318 expressed protein 27 8.5 At5g43500.1 68418.m05319 expressed protein 27 8.5 >At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 377 Score = 122 bits (294), Expect = 1e-28 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPGIVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 Actin 8 {Arabidopsis thaliana}; nearly identical to SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and to At3g18780 Length = 377 Score = 122 bits (294), Expect = 1e-28 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPGIVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana} Length = 377 Score = 121 bits (292), Expect = 2e-28 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKSEYDESGPSIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 Actin 4 {Arabidopsis thaliana} Length = 377 Score = 120 bits (288), Expect = 7e-28 Identities = 53/61 (86%), Positives = 58/61 (95%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 Actin 3 {Arabidopsis thaliana}; supported by full-length cDNA: Ceres: 19581. Length = 377 Score = 120 bits (288), Expect = 7e-28 Identities = 53/61 (86%), Positives = 58/61 (95%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497 Actin 12 {Arabidopsis thaliana} Length = 377 Score = 120 bits (288), Expect = 7e-28 Identities = 53/61 (86%), Positives = 58/61 (95%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496 Actin 11 {Arabidopsis thaliana} Length = 377 Score = 120 bits (288), Expect = 7e-28 Identities = 53/61 (86%), Positives = 58/61 (95%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 Actin 1 (Actin 3) {Arabidopsis thaliana} Length = 377 Score = 120 bits (288), Expect = 7e-28 Identities = 53/61 (86%), Positives = 58/61 (95%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKC Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC 376 Query: 285 F 283 F Sbjct: 377 F 377 >At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Arabidopsis thaliana] gi|9293903|dbj|BAB01806 Length = 329 Score = 106 bits (255), Expect = 7e-24 Identities = 46/61 (75%), Positives = 55/61 (90%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALA + ++IKI+APPERKYSVWIGGSILASLST++QMWI+K EY+E+GP IVH KC Sbjct: 269 KEINALAAANMRIKIVAPPERKYSVWIGGSILASLSTYEQMWITKAEYEENGPAIVHTKC 328 Query: 285 F 283 F Sbjct: 329 F 329 >At2g42100.1 68415.m05205 actin, putative very strong similarity to SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493 Actin 3 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 378 Score = 105 bits (253), Expect = 1e-23 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KEI ALAP ++KIK++APPERKYSVW+GGSILASLS+F MWI+K EYDE G IVHRKC Sbjct: 318 KEINALAPPSMKIKVVAPPERKYSVWVGGSILASLSSFAPMWITKAEYDEQGGAIVHRKC 377 Query: 285 F 283 F Sbjct: 378 F 378 >At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin 11 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 366 Score = 97.9 bits (233), Expect = 3e-21 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 286 KE+ AL PS++K+K++ PPE + SVWIGGSILASLSTF QMWI+K+EY+E G IVHRKC Sbjct: 306 KELNALVPSSMKVKVVVPPESECSVWIGGSILASLSTFHQMWITKDEYEEHGAAIVHRKC 365 >At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 371 Score = 78.6 bits (185), Expect = 2e-15 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 465 KEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 331 KEI ALAPS++KIK++APPERKYSVWIGGSILASLSTFQQ+ I + Sbjct: 317 KEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQVKIDQ 361 >At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary identical to actin-related protein 4 (ARP4) [Arabidopsis thaliana] GI:21427463; contains Pfam profile PF00022: Actin; supporting cDNA gi|21427462|gb|AF507912.1| Length = 441 Score = 74.5 bits (175), Expect = 3e-14 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 3/64 (4%) Frame = -3 Query: 468 QKEIXALAPSTIKIKIIAP---PERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIV 298 +K++ +P + ++K++A ER++SVWIGGSILASL +FQQMW SK EY+E G + Sbjct: 377 EKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYI 436 Query: 297 HRKC 286 RKC Sbjct: 437 QRKC 440 >At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical to actin-related protein 7 (ARP7) [Arabidopsis thaliana] GI:21427469; contains Pfam profile PF00022: Actin Length = 363 Score = 59.7 bits (138), Expect = 1e-09 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 6/68 (8%) Frame = -3 Query: 468 QKEIXALAPSTIKIKIIAPPERK------YSVWIGGSILASLSTFQQMWISKEEYDESGP 307 QKE L S I+ ++ PPE YS W+GG+ILA + Q ++K +YDE+GP Sbjct: 297 QKEAN-LCSSAIRPTLVKPPEYMPENLGMYSAWVGGAILAKVVFPQNQHVTKADYDETGP 355 Query: 306 GIVHRKCF 283 +VHRKCF Sbjct: 356 SVVHRKCF 363 >At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly identical to actin-related protein 6 (ARP6) [Arabidopsis thaliana] GI:21427467; contains Pfam profile PF00022: Actin Length = 421 Score = 46.0 bits (104), Expect = 1e-05 Identities = 22/60 (36%), Positives = 31/60 (51%) Frame = -3 Query: 462 EIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 283 E+ L P +KI + VW GGS+LAS F+ M ++K EY+E G R+ F Sbjct: 361 ELRPLVPDHFDVKITTQEDPILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFF 420 >At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical to actin-related protein 3 (ARP3) [Arabidopsis thaliana] GI:21427461; contains Pfam profile PF00022: Actin Length = 427 Score = 43.2 bits (97), Expect = 9e-05 Identities = 16/45 (35%), Positives = 30/45 (66%) Frame = -3 Query: 435 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGI 301 +++ +++ P ++++VW GGS+L+S F +KEEY+E G I Sbjct: 372 VEVNVVSHPVQRFAVWFGGSVLSSTPEFFASCRTKEEYEEYGASI 416 >At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly identical to actin-related protein 2 (ARP2) [Arabidopsis thaliana] GI:3818624; contains Pfam profile PF00022: Actin Length = 389 Score = 41.5 bits (93), Expect = 3e-04 Identities = 16/43 (37%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = -3 Query: 435 IKIKIIAPPERKYSVWIGGSILAS-LSTFQQMWISKEEYDESG 310 ++++I PP RK+ V++GG++LA + + WI++E+Y E G Sbjct: 337 LRLRIEDPPRRKHMVYLGGAVLAGIMKDAPEFWINREDYMEEG 379 >At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) strong similarity to actin-related protein 8A (ARP8) [Arabidopsis thaliana] GI:21427473; contains Pfam profile PF00022: Actin; supporting cDNA gi|21427470|gb|AF507916.1| Length = 471 Score = 29.9 bits (64), Expect = 0.91 Identities = 15/52 (28%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = -3 Query: 468 QKEIXALAPSTIK--IKIIAPPERKYSVWIGGSILASLSTFQQMW-ISKEEY 322 ++E+ PS+I I++I PP + W G ++++LS F W I+++++ Sbjct: 412 ERELQDHLPSSISNGIRVIPPPYGVDTSWHGAKLISNLSIFPGPWCITRKQF 463 >At5g43500.2 68418.m05318 expressed protein Length = 584 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -3 Query: 408 ERKYSVWIGGSILASLSTFQQMWISKEEYDESG 310 E ++ W GG+IL L ++ WI + ++ +G Sbjct: 527 EPQFVTWKGGAILGILDFGREAWIERHQWMVNG 559 >At5g43500.1 68418.m05319 expressed protein Length = 596 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -3 Query: 408 ERKYSVWIGGSILASLSTFQQMWISKEEYDESG 310 E ++ W GG+IL L ++ WI + ++ +G Sbjct: 539 EPQFVTWKGGAILGILDFGREAWIERHQWMVNG 571 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,350,376 Number of Sequences: 28952 Number of extensions: 151981 Number of successful extensions: 399 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -