BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30629 (833 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 24 1.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 24 1.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 2.0 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.1 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 24.2 bits (50), Expect = 1.5 Identities = 12/63 (19%), Positives = 32/63 (50%) Frame = +3 Query: 459 LFDNYHKNVIRPEFVTPNEETEQTTYINTILATGPIRSLITFLVNKGITQLNEYPEQVEL 638 +FD+ + +RP +++P Q ++A + +L+ ++ T+ YP++ ++ Sbjct: 608 IFDSASRTAVRPRYISP---ASQVCIAAALIALQIVLTLVWMIIEPPGTRF-FYPDRKQV 663 Query: 639 LRK 647 + K Sbjct: 664 ILK 666 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 24.2 bits (50), Expect = 1.5 Identities = 12/63 (19%), Positives = 32/63 (50%) Frame = +3 Query: 459 LFDNYHKNVIRPEFVTPNEETEQTTYINTILATGPIRSLITFLVNKGITQLNEYPEQVEL 638 +FD+ + +RP +++P Q ++A + +L+ ++ T+ YP++ ++ Sbjct: 698 IFDSASRTAVRPRYISP---ASQVCIAAALIALQIVLTLVWMIIEPPGTRF-FYPDRKQV 753 Query: 639 LRK 647 + K Sbjct: 754 ILK 756 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 2.0 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -2 Query: 754 RPR-PSLDLSSAINTFSKAQLHLQRPVQ 674 RP+ PS+D + ++T SKA L L P Q Sbjct: 210 RPKFPSMDNINGLSTESKADLPLLCPAQ 237 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 6.1 Identities = 9/22 (40%), Positives = 11/22 (50%), Gaps = 1/22 (4%) Frame = -3 Query: 195 LCLFAGKCFELCSLAD-QSHDC 133 LC + CF LC D + DC Sbjct: 736 LCRYEAHCFALCHCCDFDACDC 757 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,779 Number of Sequences: 438 Number of extensions: 4677 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -