BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30623 (355 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0925 - 12440917-12441560,12441675-12441810 31 0.26 01_01_0017 + 133311-133615,133698-133824,133912-134253 29 1.1 06_01_0900 + 6926600-6927202 28 1.8 05_01_0188 - 1357074-1357098,1357811-1357941,1358572-1358667,135... 28 2.4 01_06_1408 - 37088014-37088448,37088892-37089167,37090777-37092297 26 7.4 05_01_0356 + 2785410-2785670,2785843-2785960,2786800-2786891,278... 26 9.8 >03_02_0925 - 12440917-12441560,12441675-12441810 Length = 259 Score = 31.1 bits (67), Expect = 0.26 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = -3 Query: 248 NVFTKGYFVTLLIFIYIIYYRGVCIESASECVGCTCAREHRRDTPPTSAPHTRTCT 81 N++++GY + ++ RG+ S C CA +HRR P A T T T Sbjct: 53 NLYSQGYGTSTAALSTALFNRGL---SCGSCYELRCAGDHRRSCLPGGATVTVTAT 105 >01_01_0017 + 133311-133615,133698-133824,133912-134253 Length = 257 Score = 29.1 bits (62), Expect = 1.1 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 170 SASECVGCTCAREHRRDTPPTSAPHTRT 87 S+S C + R+ PP APHT T Sbjct: 6 SSSTASAAACCKSRSRNPPPAPAPHTST 33 >06_01_0900 + 6926600-6927202 Length = 200 Score = 28.3 bits (60), Expect = 1.8 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 101 VRRWGACLGGARARTCIRRTRSHSRYILHG 190 VR W + G R +T IRR R R+ HG Sbjct: 76 VREWSELVAGPRWKTFIRRFRRSPRHHHHG 105 >05_01_0188 - 1357074-1357098,1357811-1357941,1358572-1358667, 1358736-1358769,1358867-1358958,1359273-1359332, 1359376-1359435,1360016-1360525,1360645-1360719, 1360809-1361015 Length = 429 Score = 27.9 bits (59), Expect = 2.4 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +3 Query: 177 TYSTVINNINKYQQRYKIAFRKNIRSLKCIYFCLAYKKKRIAYLVFYSFSLIINS 341 T TV++ N Y + N+ I F +K KR+AYL Y + +IN+ Sbjct: 35 TTKTVLDPWNPYFPLWPPEIPPNLGLNGAICFIEDWKMKRMAYLASYRSTCVINA 89 >01_06_1408 - 37088014-37088448,37088892-37089167,37090777-37092297 Length = 743 Score = 26.2 bits (55), Expect = 7.4 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -3 Query: 221 TLLIFIYIIYYRGVCIESASECVGCTCAREHRRDTPPTSAPHTRTCTPR 75 TLL+ ++ + + SAS+ VGC+C RR T+ C+PR Sbjct: 683 TLLLRVFSVSHAAAA--SASQVVGCSCQVRLRR-RALTTRRRELPCSPR 728 >05_01_0356 + 2785410-2785670,2785843-2785960,2786800-2786891, 2787114-2787176,2787299-2787397,2787726-2787884, 2788420-2788491,2788567-2788699,2788813-2788877, 2789016-2789091,2789236-2789337,2789524-2789716, 2790576-2790654,2792939-2793007,2793261-2793311, 2793680-2793742,2793926-2794041,2794263-2794347, 2794898-2794957,2795594-2795639,2796011-2796084, 2796350-2796400,2796474-2796674,2796747-2796791, 2797063-2797156,2797226-2797371,2797510-2797739, 2798136-2798196,2798290-2798347,2799020-2799513 Length = 1151 Score = 25.8 bits (54), Expect = 9.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 318 CKILNMQFFFFCKPNK 271 C+I +FFFFC P++ Sbjct: 316 CRIAARKFFFFCDPHR 331 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,406,953 Number of Sequences: 37544 Number of extensions: 147981 Number of successful extensions: 432 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 530315984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -