BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30623 (355 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 25 0.20 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 0.46 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 2.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 2.5 DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 21 3.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 5.7 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 20 9.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 20 9.9 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 25.4 bits (53), Expect = 0.20 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = -3 Query: 191 YRGVCIE----SASECVGCTCAREHRRDTPPTSAPHTRTCTPRTLHLTSNKAIS 42 Y G+C E S ++C+GC+ + T PH + + S+ AI+ Sbjct: 75 YLGICAEGMQCSCNKCIGCSAEKFECSKTSNPCLPHRNSDRDLNIRKWSSIAIN 128 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 0.46 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -3 Query: 137 REHRRDTPPTSAPHTRTCTPRT 72 R+H + P PH TCT T Sbjct: 1073 RQHTAEGVPEQPPHDTTCTTLT 1094 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 2.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 302 IFSILQFFAHHQQ 340 IFS++ F AH QQ Sbjct: 333 IFSVVGFMAHEQQ 345 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 2.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 302 IFSILQFFAHHQQ 340 IFS++ F AH QQ Sbjct: 386 IFSVVGFMAHEQQ 398 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 21.4 bits (43), Expect = 3.3 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 246 CFYERLFCNVVDIYLYYLLPWSMYRECER 160 C +R C+V+ + LLP + C R Sbjct: 39 CILDRGHCDVIGKKIKELLPEVLNNHCNR 67 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 128 GARARTCIRRTRSHSRY 178 G+R+R+ R + HSRY Sbjct: 218 GSRSRSFQRTSSCHSRY 234 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 19.8 bits (39), Expect = 9.9 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 2 PPGCRFFF 25 PPG RFF+ Sbjct: 650 PPGTRFFY 657 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 19.8 bits (39), Expect = 9.9 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 2 PPGCRFFF 25 PPG RFF+ Sbjct: 740 PPGTRFFY 747 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,367 Number of Sequences: 438 Number of extensions: 1653 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8184330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -