BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30611 (669 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3F6.05 |rga1||GTPase activating protein Rga1|Schizosaccharom... 30 0.35 SPAC2E1P5.04c |cwg2|orb7|geranylgeranyltransferase I beta subuni... 25 7.5 SPAC24C9.08 |||vacuolar carboxypeptidase |Schizosaccharomyces po... 25 7.5 >SPBC3F6.05 |rga1||GTPase activating protein Rga1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1150 Score = 29.9 bits (64), Expect = 0.35 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -1 Query: 591 SLCAILTFPIPEPTYNTQQTLIATPYFDGYLPLICITSASKI*G 460 SL A FPI +PT N Q L T YF L L+C + + G Sbjct: 147 SLVASKFFPIDDPTLNKQVPLCETDYF-RRLDLLCASCGMALRG 189 >SPAC2E1P5.04c |cwg2|orb7|geranylgeranyltransferase I beta subunit Cwg2|Schizosaccharomyces pombe|chr 1|||Manual Length = 355 Score = 25.4 bits (53), Expect = 7.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +2 Query: 506 PSK*GVAISVCCVLYVGSGIGNVN 577 P G S+CC+L++G + ++ Sbjct: 95 PQLAGTVFSICCLLFLGDNLSRID 118 >SPAC24C9.08 |||vacuolar carboxypeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 596 Score = 25.4 bits (53), Expect = 7.5 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -3 Query: 568 SDTRTNIQHTTNAYRYTLLRRLSTS-NLY--H*CKQNLRYSVR*SNC*YLY 425 +DTR T+N YR+T + STS N + H +N+RY + + Y Sbjct: 534 TDTRHYWNLTSNIYRWTPVSTNSTSKNSFNGHTINENMRYDAHMDSIEFFY 584 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,473,650 Number of Sequences: 5004 Number of extensions: 46021 Number of successful extensions: 75 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 305854096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -