BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30606 (713 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 25 0.094 AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 23 3.3 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 23 3.3 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 23 3.3 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 22 5.7 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 25.4 bits (53), Expect(2) = 0.094 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +2 Query: 389 GGVRTNGACLEPRS--IAKAPPGEGCPRCGG 475 G NG CL+ K PPG PRC G Sbjct: 267 GACHNNGTCLDKVGGFECKCPPGFVGPRCEG 297 Score = 20.6 bits (41), Expect(2) = 0.094 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 209 CFKCGLCQKLLDSTNCSEHEGEL 277 C G C L++S +CS G L Sbjct: 231 CQNGGTCHDLVNSFSCSCPSGTL 253 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 22.6 bits (46), Expect = 3.3 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -2 Query: 202 VPFEATSHALLSGVN*FATFRALRVISGFERHCARLTYPVRRVG 71 V F T ALL G + T L +I+ +CA R VG Sbjct: 141 VVFLLTLSALLEGFTLYHTTAYLHIITMINMNCALWYINCRAVG 184 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 22.6 bits (46), Expect = 3.3 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -2 Query: 202 VPFEATSHALLSGVN*FATFRALRVISGFERHCARLTYPVRRVG 71 V F T ALL G + T L +I+ +CA R VG Sbjct: 141 VVFLLTLSALLEGFTLYHTTAYLHIITMINMNCALWYINCRAVG 184 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 22.6 bits (46), Expect = 3.3 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -2 Query: 202 VPFEATSHALLSGVN*FATFRALRVISGFERHCARLTYPVRRVG 71 V F T ALL G + T L +I+ +CA R VG Sbjct: 141 VVFLLTLSALLEGFTLYHTTAYLHIITMINMNCALWYINCRAVG 184 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +1 Query: 646 MVTGKGAGVLQSDPYANGDQAP 711 M+ G G++ PY N AP Sbjct: 7 MMGHTGGGLMPPQPYMNAQDAP 28 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,546 Number of Sequences: 336 Number of extensions: 3517 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -