BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30605 (499 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125969-2|AAD14761.1| 613|Caenorhabditis elegans Caenorhabditi... 30 0.81 L40996-1|AAA86431.1| 593|Caenorhabditis elegans GTP-binding pro... 27 7.6 AF003389-1|AAC71138.2| 865|Caenorhabditis elegans Hypothetical ... 27 10.0 >AF125969-2|AAD14761.1| 613|Caenorhabditis elegans Caenorhabditis gtp-binding proteinprotein 1 protein. Length = 613 Score = 30.3 bits (65), Expect = 0.81 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = -3 Query: 485 GELGTGPPLEKVWQERAEQFGGRQKARLPKWFGERP--GKKKGELE 354 G + + P E + Q+RA+Q GRQK K G +P GK K ++E Sbjct: 546 GTVSSVVPQESLAQQRAKQKDGRQKQYGKKSMGPKPPNGKPKEKIE 591 >L40996-1|AAA86431.1| 593|Caenorhabditis elegans GTP-binding protein protein. Length = 593 Score = 27.1 bits (57), Expect = 7.6 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -3 Query: 485 GELGTGPPLEKVWQERAEQFGGRQKARLPKWFGERP 378 G + + P E + Q+RA+Q GRQK K G +P Sbjct: 546 GTVSSVVPQESLAQQRAKQKDGRQKQYGKKSMGPKP 581 >AF003389-1|AAC71138.2| 865|Caenorhabditis elegans Hypothetical protein F23H11.2 protein. Length = 865 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 106 KLMDWLQNCRTRPARVEGPISGASDFY 186 K DW+QNC R P++G FY Sbjct: 673 KRPDWIQNCTARQTHF-NPVTGPIRFY 698 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,183,721 Number of Sequences: 27780 Number of extensions: 99901 Number of successful extensions: 351 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 351 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -