BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30601 (787 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 23 4.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 5.6 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 9.8 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 22.6 bits (46), Expect = 4.3 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +3 Query: 330 VNLRTLTTPTKILLRGFAKTTMNASLVLKMKNSIWN 437 + + + P LL GF ++T + + ++ N WN Sbjct: 13 IGVLLMLAPINALLLGFVQSTPDNNKTVREFNVYWN 48 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 5.6 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = +1 Query: 481 PSQRPQRQIRQAHTKEGF---QIRKQIRQAPEEGRRIQLP*PIEGREKEGIHLGRGRQ 645 P P++Q +QA +G + +Q + AP+ LP P+ + RGRQ Sbjct: 219 PGMHPRQQ-QQAQQHQGVVTSPLSQQQQAAPQGAASANLPSPLYPWMRSQFERKRGRQ 275 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 9.8 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -2 Query: 573 AFFWSLANL--FSYLETFFSVGLTNLPLRSLTWEFRSE 466 +F + +A L F+ + F VG +PL WE +E Sbjct: 314 SFGYCIATLLEFAGVHYFTKVGSGEIPLEEEEWENENE 351 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,463 Number of Sequences: 438 Number of extensions: 3037 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -