BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30599 (740 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 23 3.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 6.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 6.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.0 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -3 Query: 612 KVNSFFFTTFNWLRKLNSAAFFWSLANLFSYLETFFSVGLTNL 484 K+N+FF N + + +FS+ TFFS + L Sbjct: 11 KLNTFFLKALTVWHVENPTYRLYKIFVVFSFAVTFFSAWICAL 53 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 368 DYHERIARLEDEKFDLEYIVKR 433 DYH R F +EY+V R Sbjct: 835 DYHGAWERQTGHNFTMEYLVSR 856 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 592 EKEGIHLGKRKTKRKSLTG 648 EK+ KRK K+KSL G Sbjct: 1076 EKKQAEEAKRKAKQKSLLG 1094 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 592 EKEGIHLGKRKTKRKSLTG 648 EK+ KRK K+KSL G Sbjct: 1076 EKKQAEEAKRKAKQKSLLG 1094 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 592 EKEGIHLGKRKTKRKSLTG 648 EK+ KRK K+KSL G Sbjct: 1076 EKKQAEEAKRKAKQKSLLG 1094 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 592 EKEGIHLGKRKTKRKSLTG 648 EK+ KRK K+KSL G Sbjct: 1076 EKKQAEEAKRKAKQKSLLG 1094 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,121 Number of Sequences: 336 Number of extensions: 1955 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -