BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30599 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 25 0.99 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 24 1.3 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 23 4.0 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 22 5.3 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 22 5.3 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 24.6 bits (51), Expect = 0.99 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = -3 Query: 618 LPKVNSFFFTTFNWLRKLNSAAFFWSLANL--FSYLETFFSVGLTNLPLRSLTWEFRSE 448 LPKV + T +W ++ F + +A L F+ + F VG +PL WE +E Sbjct: 298 LPKVR--YATALDWFLLMS---FGYCIATLLEFAGVHYFTKVGSGEIPLEEEEWENENE 351 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/68 (19%), Positives = 29/68 (42%) Frame = +1 Query: 445 DLRPELPSQRPQRQIRQAHTKEGFQIRKQIRQAPEEGRRIQLP*PIEGREKEGIHLGKRK 624 + +P++ QR ++ T+ + + + P G+R + IE + + K Sbjct: 178 EYKPDVEEQRYKQVEISQMTEPSSSTKSYVLEGPRNGKRKRKSSTIENESETESNASSTK 237 Query: 625 TKRKSLTG 648 TK + +G Sbjct: 238 TKMRRKSG 245 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +3 Query: 312 VNLRTLTTPTKILLRGFAKTTMNASLVLKMKNSIWN 419 + + + P LL GF ++T + + ++ N WN Sbjct: 13 IGVLLMLAPINALLLGFVQSTPDNNKTVREFNVYWN 48 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -3 Query: 630 LCLPLPKVNS 601 LCLP P++NS Sbjct: 46 LCLPAPRINS 55 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -3 Query: 630 LCLPLPKVNS 601 LCLP P++NS Sbjct: 46 LCLPAPRINS 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,239 Number of Sequences: 438 Number of extensions: 2187 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -