BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30597 (664 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51010.1 68416.m05585 expressed protein 33 0.22 At5g45520.1 68418.m05591 hypothetical protein 30 1.6 At4g37460.1 68417.m05302 tetratricopeptide repeat (TPR)-containi... 30 1.6 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 30 1.6 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 30 1.6 At5g05210.1 68418.m00555 nucleolar matrix protein-related contai... 29 2.8 At5g03660.1 68418.m00325 expressed protein low similarity to out... 29 2.8 At3g23930.1 68416.m03006 expressed protein 29 2.8 At2g25350.1 68415.m03032 phox (PX) domain-containing protein wea... 29 2.8 At5g41540.1 68418.m05048 disease resistance protein (TIR-NBS-LRR... 29 3.6 At5g25070.1 68418.m02971 expressed protein 29 3.6 At3g43160.1 68416.m04554 expressed protein merozoite surface pro... 29 3.6 At1g01670.1 68414.m00085 U-box domain-containing protein 29 3.6 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 28 6.4 At1g05320.1 68414.m00539 myosin-related similar to non-muscle my... 28 6.4 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 27 8.4 At1g13220.2 68414.m01534 nuclear matrix constituent protein-rela... 27 8.4 At1g13220.1 68414.m01533 nuclear matrix constituent protein-rela... 27 8.4 >At3g51010.1 68416.m05585 expressed protein Length = 188 Score = 32.7 bits (71), Expect = 0.22 Identities = 22/66 (33%), Positives = 34/66 (51%) Frame = +3 Query: 432 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEE 611 I ++R + +KKRQA++Q K + +++K A ER +QLEEE Sbjct: 125 IGQRRAFILSEKKKRQALVQEAKRKKRIKQ---VERKMAAVARDRAWAERLIELQQLEEE 181 Query: 612 KKISLS 629 KK S+S Sbjct: 182 KKKSMS 187 >At5g45520.1 68418.m05591 hypothetical protein Length = 1167 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 5/68 (7%) Frame = +3 Query: 429 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENF-----GLSNAQLERNKTK 593 ++E+ ++ E E++ + +++ KT P+ +K +N G SN + + +K K Sbjct: 624 NLEDGKKHDEGKEERSLKSDEVVEEEKKTSPSEEATEKFQNKPGDQKGKSNVEGDGDKGK 683 Query: 594 EQLEEEKK 617 LEEEKK Sbjct: 684 ADLEEEKK 691 >At4g37460.1 68417.m05302 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 883 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/59 (32%), Positives = 29/59 (49%) Frame = +1 Query: 157 NKRVDRRSRVREIQNSSSVKTRSGRTWMNS*RNTSTNGANSGPRRRMSSNALKRSRPSA 333 NKR R + + I+ + V W NS + T+ NG + RRR +N L ++R A Sbjct: 675 NKRQHRMAGLAVIEIAQKVSKAWRIEWRNSTKGTTKNGKKN--RRRERTNILSQNRGGA 731 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +3 Query: 432 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNA-QLERNKTKEQLEE 608 ++ K++ KK++ + K +KTG + +KK+ + +S +++RN T E+ + Sbjct: 898 VDVKQETGSPDTKKKEGASSSSKKDTKTGEDKKAEKKNNSETMSEGKKIDRNNTDEKEVK 957 Query: 609 EKKISLSIR 635 EK I+ Sbjct: 958 EKVTEKEIK 966 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 29.9 bits (64), Expect = 1.6 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 4/74 (5%) Frame = +3 Query: 435 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTK---EQLE 605 +EKR+R+EE E+K +KD N ++ + E SN +LE N K + + Sbjct: 112 DEKRKRMEELEEKLVVNESLIKDLQLQVLN--LKTELEEARNSNVELELNNRKLSQDLVS 169 Query: 606 EEKKI-SLSIRIKP 644 E KI SLS KP Sbjct: 170 AEAKISSLSSNDKP 183 >At5g05210.1 68418.m00555 nucleolar matrix protein-related contains Pfam domain, PF04935: Surfeit locus protein 6 Length = 386 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/59 (20%), Positives = 33/59 (55%) Frame = +3 Query: 444 RQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEKKI 620 +Q + + +K+++ + K+ + F ++K+ + G ++E+NK ++ + EKK+ Sbjct: 310 KQSIHKDKKRQEKNAEKWKERIEGQQKFKVEKQQKRSGNIADRIEQNKMRKIAKREKKL 368 >At5g03660.1 68418.m00325 expressed protein low similarity to outer surface protein F [Borrelia burgdorferi] GI:466482; contains Pfam profile PF04949: Family of unknown function (DUF662) Length = 173 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 495 MKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEKKISLSIRIK 641 +KD +F+ Q K E+ LS L K KE+ E+KK+ + R++ Sbjct: 18 LKDQLSESMSFSSQMKKEDDELSMKALSAFKAKEEEIEKKKMEIRERVQ 66 >At3g23930.1 68416.m03006 expressed protein Length = 224 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 189 GDPEFIKRQDQKRSDLDEQLKEYINEWRKQR 281 G IK +D++ + QLKE EWRK+R Sbjct: 26 GRRHLIKERDEREKVMFLQLKEAEREWRKER 56 >At2g25350.1 68415.m03032 phox (PX) domain-containing protein weak similarity to SP|Q9UTK5 Abnormal long morphology protein 1 (Sp8) {Schizosaccharomyces pombe}; contains Pfam profile PF00787: PX domain Length = 643 Score = 29.1 bits (62), Expect = 2.8 Identities = 23/71 (32%), Positives = 34/71 (47%) Frame = +3 Query: 429 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE 608 D+EE RQ+ E E K ++ D SKT N TI + E E + TK+QLE+ Sbjct: 455 DMEELRQKTFEMELKLKSKEDGSSD-SKTSGNSTISESHE------LLQEMDATKQQLED 507 Query: 609 EKKISLSIRIK 641 + + + K Sbjct: 508 LSRRYVELEAK 518 >At5g41540.1 68418.m05048 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1038 Score = 28.7 bits (61), Expect = 3.6 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = +3 Query: 429 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLE 578 D EKRQ L EAE+ R + S G +F + K SE F +S E Sbjct: 502 DEPEKRQFLVEAEEIRDVLANETGTGSVLGISFDMSKVSE-FSISGRAFE 550 >At5g25070.1 68418.m02971 expressed protein Length = 736 Score = 28.7 bits (61), Expect = 3.6 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +3 Query: 438 EKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE-EK 614 EKR EAEKK A + K+A + + KS N Q+E K +LE+ E Sbjct: 565 EKRMPELEAEKKVAASTRNFKEAGR----IAAEAKSLNLEKDKTQMETGKANAELEKAEH 620 Query: 615 KISLSIR 635 +I +I+ Sbjct: 621 EIEETIK 627 >At3g43160.1 68416.m04554 expressed protein merozoite surface protein 2 (MSP-2), EMBL:PFU72951, Plasmodium falciparum Length = 295 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 166 VDRRSRVREIQNSSSVKTRSGRTWMNS*RNTSTNGANSGPRRRMSSNALKRSR 324 +D+ + +S+ +TRSGR +++ +ST NS R SS K R Sbjct: 91 IDQELKSSTGSENSTTRTRSGRGFIDYVLESSTGTENSSTRTAESSTRTKNGR 143 >At1g01670.1 68414.m00085 U-box domain-containing protein Length = 365 Score = 28.7 bits (61), Expect = 3.6 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 6/73 (8%) Frame = +3 Query: 435 EEKRQRLEEAEKKRQ-----AMLQAMKDASKTGPNFT-IQKKSENFGLSNAQLERNKTKE 596 EE+R+RLE E KR+ M + ++A + T I E + E N+ K Sbjct: 177 EEQRRRLEIEELKREKEQRDKMRRVREEALSSSSGVTKILYNEEVMRRREVEAELNRAKA 236 Query: 597 QLEEEKKISLSIR 635 ++E+ K++ + ++ Sbjct: 237 EIEDMKRVQIELK 249 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 27.9 bits (59), Expect = 6.4 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 4/54 (7%) Frame = +1 Query: 175 RSRVREIQNSSSVKTRSG-RTWMNS*RNTSTN---GANSGPRRRMSSNALKRSR 324 RS +R ++ S KT SG +++ ++ ST+ A+ PR+R SN+ +RSR Sbjct: 209 RSPLRGSRSRSISKTNSGSKSYSGERKSRSTSQSSDASISPRKRRLSNSRRRSR 262 >At1g05320.1 68414.m00539 myosin-related similar to non-muscle myosin II heavy chain (GI:19879404) [Loligo pealei]; ESTs gb|AA042402,gb|ATTS1380 come from this gene Length = 828 Score = 27.9 bits (59), Expect = 6.4 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 3/68 (4%) Frame = +3 Query: 432 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKT---KEQL 602 +E+K + LEE +K + A+ A + G +IQ + +S + N++ +L Sbjct: 155 LEQKLKSLEELSEKVSELKSALIVAEEEGKKSSIQMQEYQEKVSKLESSLNQSSARNSEL 214 Query: 603 EEEKKISL 626 EE+ +I+L Sbjct: 215 EEDLRIAL 222 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 27.5 bits (58), Expect = 8.4 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +3 Query: 438 EKRQRLEE-AEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQL---E 605 E+R++ EE A K+ +A + ++A + T +KK E + ER + +E+ E Sbjct: 444 ERRRKEEEEARKREEAKRREEEEAKRREEEETERKKREEEEARKREEERKREEEEAKRRE 503 Query: 606 EEKK 617 EE+K Sbjct: 504 EERK 507 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/61 (18%), Positives = 32/61 (52%) Frame = +3 Query: 435 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEK 614 EE+++ EEA+++ + + ++A + ++K E + + K +E++E ++ Sbjct: 490 EERKREEEEAKRREEERKKREEEAEQARKREEEREKEEEMAKKREEERQRKEREEVERKR 549 Query: 615 K 617 + Sbjct: 550 R 550 >At1g13220.2 68414.m01534 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1128 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 162 ESRPSIAGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQ 278 E+R S+ + F K ++ +Q +EY+NEW K+ Sbjct: 234 ETRESVLQQERLSFTKERESYEGTFQKQ-REYLNEWEKK 271 >At1g13220.1 68414.m01533 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 391 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 162 ESRPSIAGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQ 278 E+R S+ + F K ++ +Q +EY+NEW K+ Sbjct: 247 ETRESVLQQERLSFTKERESYEGTFQKQ-REYLNEWEKK 284 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,765,834 Number of Sequences: 28952 Number of extensions: 146044 Number of successful extensions: 629 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -