BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30589 (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 23 2.0 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 23 3.5 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 23 3.5 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 23 3.5 AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 22 4.6 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 131 KWRIRGCAKGRCDPLQIGQQISSWISE 211 K R++ D LQ+GQ S W +E Sbjct: 119 KERLKTQGISHLDKLQLGQYFSPWFAE 145 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 22.6 bits (46), Expect = 3.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 196 ANLLANLQRITPSLSTSSYAPFGSGSPKTSEIQVRTSCS 80 +N+L NL ITP+++ + SP + RTS S Sbjct: 126 SNILQNLADITPNVTPNCDVKSSVCSPGSGHQDSRTSPS 164 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 22.6 bits (46), Expect = 3.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 196 ANLLANLQRITPSLSTSSYAPFGSGSPKTSEIQVRTSCS 80 +N+L NL ITP+++ + SP + RTS S Sbjct: 126 SNILQNLADITPNVTPNCDVKSSVCSPGSGHQDSRTSPS 164 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 22.6 bits (46), Expect = 3.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 196 ANLLANLQRITPSLSTSSYAPFGSGSPKTSEIQVRTSCS 80 +N+L NL ITP+++ + SP + RTS S Sbjct: 126 SNILQNLADITPNVTPNCDVKSSVCSPGSGHQDSRTSPS 164 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 22.2 bits (45), Expect = 4.6 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 24 TSLETRFRLHTMPARNKDQEQEVLTWISDVLGEPLPNGAYEDV 152 T++ F L + A +KD ++ +L + DVLG+ Y D+ Sbjct: 1 TAVALNFALMLI-ACHKDVQETILQEMRDVLGDIHAKPTYSDL 42 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,725 Number of Sequences: 336 Number of extensions: 4877 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -