BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30583 (765 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0001552FC9 Cluster: PREDICTED: hypothetical protein;... 33 7.8 UniRef50_A5BM32 Cluster: Putative uncharacterized protein; n=1; ... 33 7.8 >UniRef50_UPI0001552FC9 Cluster: PREDICTED: hypothetical protein; n=1; Mus musculus|Rep: PREDICTED: hypothetical protein - Mus musculus Length = 52 Score = 33.1 bits (72), Expect = 7.8 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 Query: 670 PMLTNTSLYRRARARTVLPTRSGPSSNALPPRN 572 P+L NTS RR RA +L + GP + PRN Sbjct: 18 PLLFNTSALRRQRALGLLDHQGGPEHGTISPRN 50 >UniRef50_A5BM32 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 1262 Score = 33.1 bits (72), Expect = 7.8 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 307 KCIWRRKLSFRMLSSWYCRNLRRCRSSICK*ATER 411 K +W +S+R + S C NL RC +I K T+R Sbjct: 128 KALWDEYISYRPIPSCRCGNLNRCSCNILKDLTDR 162 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,244,259 Number of Sequences: 1657284 Number of extensions: 15693368 Number of successful extensions: 33463 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33449 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 63792713725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -