BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30583 (765 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosa... 31 0.18 SPBC25B2.11 |pof2||F-box protein Pof2|Schizosaccharomyces pombe|... 27 2.2 SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple ca... 25 9.0 SPBC336.05c |||S-adenosylmethionine-dependentmethyltransferase|S... 25 9.0 >SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1076 Score = 31.1 bits (67), Expect = 0.18 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 634 RARTVLPTRSGPSSNALPPRNRSRFNVPGT 545 R + +LP RSG SS+ +P N + NVP T Sbjct: 1016 RVKPLLPPRSGSSSSGVPAPNLTPVNVPPT 1045 >SPBC25B2.11 |pof2||F-box protein Pof2|Schizosaccharomyces pombe|chr 2|||Manual Length = 463 Score = 27.5 bits (58), Expect = 2.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 304 VKCIWRRKLSFRMLSSWYCRNLRRCRSSIC 393 VKCI LS +LS + RNL R S C Sbjct: 362 VKCICLTDLSVILLSGSFSRNLERVHLSYC 391 >SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple cancers-1 homolog 2|Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 25.4 bits (53), Expect = 9.0 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 109 IHEIRFSCNSSLIVSTPASDLYVLTLVSFV 198 I E+ FS +S IVS A D+Y+ + SFV Sbjct: 220 IDELDFSVLNS-IVSLDAKDIYIRVICSFV 248 >SPBC336.05c |||S-adenosylmethionine- dependentmethyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 378 Score = 25.4 bits (53), Expect = 9.0 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 398 ERRRELNKLDRTGTSVTIKILLPVGCGDS 484 +RRR+L K+ + G V + LL +GCGD+ Sbjct: 13 QRRRKLFKILQGGFPV--RSLLDIGCGDA 39 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,177,068 Number of Sequences: 5004 Number of extensions: 64775 Number of successful extensions: 123 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -