BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30583 (765 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0214 + 18688480-18688832,18688956-18688999,18689039-186891... 29 4.1 03_05_0443 - 24379756-24379794,24379896-24379967,24380054-243801... 28 7.1 05_01_0495 - 4136871-4136906,4137043-4137171,4137545-4137694,413... 28 9.4 >03_04_0214 + 18688480-18688832,18688956-18688999,18689039-18689101, 18689883-18689956,18691526-18692017 Length = 341 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 519 DRPTIPAI*DGILSPHPTGSNIFIVTEVPV 430 DRP +P I +S +PT + I++EVP+ Sbjct: 200 DRPLVPTIKTFQISTNPTTEGLGIISEVPI 229 >03_05_0443 - 24379756-24379794,24379896-24379967,24380054-24380161, 24380264-24380373,24381500-24381605 Length = 144 Score = 28.3 bits (60), Expect = 7.1 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = -3 Query: 664 LTNTSLYRRARARTVLPTRSGPSSNALPPRNRSRFNVPGTTF--TGRDKN 521 +TNT + A + +PT SG S NA P + S +N P T T R +N Sbjct: 68 ITNTGMNTVAPTPSPMPTSSGSSYNA--PPSGSSYNAPPPTSAPTSRPQN 115 >05_01_0495 - 4136871-4136906,4137043-4137171,4137545-4137694, 4137782-4137847,4138124-4138168,4139022-4139102, 4139202-4139283,4139571-4139642,4140473-4140573, 4140690-4140806,4140929-4141249 Length = 399 Score = 27.9 bits (59), Expect = 9.4 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = -3 Query: 547 TTFTGRDKNRQTNNSGHLRWYTITASNRQ*YLYRNGGAGPV--ELIQLSPSLICISNFCI 374 TT +G NRQ NNS + W + + L + P+ + +S S + + NF Sbjct: 130 TTRSGFFYNRQVNNSVQVDWGEASMIEAERVLLAHALKDPLNERFVFVSDSCVPLYNFNY 189 Query: 373 VSDYDNTKMTTF 338 DY + T+F Sbjct: 190 TYDYIMSSSTSF 201 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,934,111 Number of Sequences: 37544 Number of extensions: 433158 Number of successful extensions: 900 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 872 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 900 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -