BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30583 (765 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051520-1|AAK92944.1| 536|Drosophila melanogaster GH17801p pro... 29 9.2 AE014134-281|AAF51348.3| 536|Drosophila melanogaster CG17660-PA... 29 9.2 >AY051520-1|AAK92944.1| 536|Drosophila melanogaster GH17801p protein. Length = 536 Score = 28.7 bits (61), Expect = 9.2 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = -2 Query: 194 KLTNVSTYKSDAGVETIKLELQENLISW--ISNGVC*INQKRLPYNRLTLTVPRHLVRTL 21 ++TNV T +S+ V +I L + + I W ++ V RL N + L++ RH TL Sbjct: 326 RITNVKTDRSELLVASIPLAVLDTGICWWIFTSLVQTTRTLRLRRNMVKLSLYRHFTNTL 385 Query: 20 V 18 + Sbjct: 386 I 386 >AE014134-281|AAF51348.3| 536|Drosophila melanogaster CG17660-PA protein. Length = 536 Score = 28.7 bits (61), Expect = 9.2 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = -2 Query: 194 KLTNVSTYKSDAGVETIKLELQENLISW--ISNGVC*INQKRLPYNRLTLTVPRHLVRTL 21 ++TNV T +S+ V +I L + + I W ++ V RL N + L++ RH TL Sbjct: 326 RITNVKTDRSELLVASIPLAVLDTGICWWIFTSLVQTTRTLRLRRNMVKLSLYRHFTNTL 385 Query: 20 V 18 + Sbjct: 386 I 386 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,898,054 Number of Sequences: 53049 Number of extensions: 743821 Number of successful extensions: 1548 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1548 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3520086471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -