BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30576 (404 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 124 3e-29 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 88 2e-18 SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) 62 2e-10 SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) 60 7e-10 SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) 39 0.002 SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) 30 0.82 SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) 30 0.82 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_28228| Best HMM Match : Cadherin (HMM E-Value=0) 29 1.9 SB_9507| Best HMM Match : Cadherin (HMM E-Value=0) 29 1.9 SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) 28 2.5 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 28 3.3 SB_53795| Best HMM Match : rve (HMM E-Value=5.9e-15) 28 3.3 SB_53279| Best HMM Match : rve (HMM E-Value=5.2e-36) 28 3.3 SB_35114| Best HMM Match : RVT_1 (HMM E-Value=2.2e-11) 28 3.3 SB_24279| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.3 SB_22769| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-07) 27 4.4 SB_9796| Best HMM Match : uDENN (HMM E-Value=1.1e-35) 27 5.8 SB_1541| Best HMM Match : MMR_HSR1 (HMM E-Value=0.12) 27 5.8 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 27 7.7 SB_9892| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0013) 27 7.7 SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26) 27 7.7 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 124 bits (299), Expect = 3e-29 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +3 Query: 183 MGKGSFKYAWVLDKLKAERERGITIDXIALWKFETSKYYVTIIDAPGHRDFIKNMITGTS 362 MGKGSFKYAWVLDKLKAERERGITID IALWKFET KYYVT+IDAPGHRDFIKNMITGTS Sbjct: 1 MGKGSFKYAWVLDKLKAERERGITID-IALWKFETLKYYVTVIDAPGHRDFIKNMITGTS 59 Query: 363 Q 365 Q Sbjct: 60 Q 60 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 88.2 bits (209), Expect = 2e-18 Identities = 37/88 (42%), Positives = 62/88 (70%) Frame = +3 Query: 132 GGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDXIALWKFETSKYYVTII 311 G +DKRT+EK+E+EA+E + ++ +W LD + ER++G T++ + F+T + T++ Sbjct: 169 GQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGNTVE-VGRAAFDTDTKHFTLL 227 Query: 312 DAPGHRDFIKNMITGTSQADCAVLIVXA 395 DAPGH+ F+ NMI+G +QAD VL++ A Sbjct: 228 DAPGHKSFVPNMISGATQADLGVLVISA 255 >SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) Length = 106 Score = 61.7 bits (143), Expect = 2e-10 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +2 Query: 38 MGKEKTHINIVVIGHVDSGKSTTTGHLIYK 127 M KEK HINIVVIGHVDSGKSTTTGHLIYK Sbjct: 1 MPKEKIHINIVVIGHVDSGKSTTTGHLIYK 30 Score = 35.9 bits (79), Expect = 0.013 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +3 Query: 132 GGIDKRTIEKFEKEAQEM 185 GGIDKRTIEKFEKE+ E+ Sbjct: 32 GGIDKRTIEKFEKESSEV 49 >SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) Length = 123 Score = 60.1 bits (139), Expect = 7e-10 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = +3 Query: 264 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVXAGT 401 + L +F+T +T++DAPGH+DFI NMITG +QAD A+L+V A T Sbjct: 3 VGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAIT 48 >SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 359 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/74 (25%), Positives = 36/74 (48%) Frame = +3 Query: 168 KEAQEMGKGSFKYAWVLDKLKAERERGITIDXIALWKFETSKYYVTIIDAPGHRDFIKNM 347 +EA + K D ++ ER+RGI++ L F + I+D PGH+DF ++ Sbjct: 38 QEAGAVKSNKIKKGATSDFMEIERQRGISVATSVL-AFNYRDKKINILDTPGHKDFAEDT 96 Query: 348 ITGTSQADCAVLIV 389 + D ++++ Sbjct: 97 FRTLTAVDSVIVVI 110 >SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) Length = 783 Score = 29.9 bits (64), Expect = 0.82 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 306 IIDAPGHRDFIKNMITGTSQADCAVLIV 389 IID PGH F G+S D A+L+V Sbjct: 682 IIDTPGHESFSNLRSRGSSLCDMAILVV 709 >SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 833 Score = 29.9 bits (64), Expect = 0.82 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 38 MGKEKTHINIVVIGHVDSGKSTTTGHLIYK 127 M K+ N+ VI HVD GKST T L+ K Sbjct: 12 MDKKLNIRNMSVIAHVDHGKSTLTDSLVSK 41 Score = 27.5 bits (58), Expect = 4.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 294 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 389 + + +ID+PGH DF + D A+++V Sbjct: 99 FLINLIDSPGHVDFSSEVTAALRVTDGALVVV 130 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 29.5 bits (63), Expect = 1.1 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 53 THINIVVIGHVDSGKSTTTGHLIY 124 T I + V+G+V+SGKST G L Y Sbjct: 111 TDIRMAVLGNVESGKSTLLGVLTY 134 >SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 29.1 bits (62), Expect = 1.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 300 VTIIDAPGHRDFIKNMITGTSQADCAVLIVXA 395 +T ID PGH F G + D VL+V A Sbjct: 78 ITFIDTPGHAAFNSMRARGANVTDIVVLVVAA 109 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +3 Query: 213 VLDKLKAERERGITI 257 VLDKL+ ERERGIT+ Sbjct: 1977 VLDKLQVERERGITV 1991 >SB_28228| Best HMM Match : Cadherin (HMM E-Value=0) Length = 838 Score = 28.7 bits (61), Expect = 1.9 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +3 Query: 201 KYAWVLDKLKAERERGITIDXIALWKFETSKYYVTIIDAPGHRDFIKNMITG 356 +YA+ +D+ RG TI + F S +I+ GH+ F+ + +TG Sbjct: 613 EYAFYVDE---NTPRGYTIGTVDAKSFSGSLLEYMVIEGSGHKRFVLDSVTG 661 >SB_9507| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2735 Score = 28.7 bits (61), Expect = 1.9 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +3 Query: 201 KYAWVLDKLKAERERGITIDXIALWKFETSKYYVTIIDAPGHRDFIKNMITG 356 +YA+ +D+ RG TI + F S +I+ GH+ F+ + +TG Sbjct: 634 EYAFYVDE---NTPRGYTIGTVDAKSFSGSLLEYMVIEGSGHKRFVLDSVTG 682 >SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) Length = 240 Score = 28.3 bits (60), Expect = 2.5 Identities = 13/54 (24%), Positives = 20/54 (37%) Frame = +3 Query: 234 ERERGITIDXIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVXA 395 E E G I + + + +D PGH F G D +++V A Sbjct: 118 EGESGGITQHIGAYSVKVGDQKIAFLDTPGHEAFTAMRARGAQVTDLVIIVVAA 171 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 27.9 bits (59), Expect = 3.3 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 234 ERERG-ITIDXIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 383 +R +G I D I WK E S Y II PG + + + S+A CA L Sbjct: 735 QRHKGKIKNDKIMRWKIELSCYSFDIIYRPGKENIPPDTL---SRATCATL 782 >SB_53795| Best HMM Match : rve (HMM E-Value=5.9e-15) Length = 615 Score = 27.9 bits (59), Expect = 3.3 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 234 ERERG-ITIDXIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 383 +R +G I D I WK E S Y II PG + + + S+A CA L Sbjct: 332 QRHKGKIKNDKIMRWKIELSCYSFDIIYRPGKENIPPDTL---SRATCATL 379 >SB_53279| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 337 Score = 27.9 bits (59), Expect = 3.3 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 234 ERERG-ITIDXIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 383 +R +G I D I WK E S Y II PG + + + S+A CA L Sbjct: 19 QRHKGKIKNDKIMRWKIELSCYSFDIIYRPGKENIPPDTL---SRATCATL 66 >SB_35114| Best HMM Match : RVT_1 (HMM E-Value=2.2e-11) Length = 512 Score = 27.9 bits (59), Expect = 3.3 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 234 ERERG-ITIDXIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 383 +R +G I D I WK E S Y II PG + + + S+A CA L Sbjct: 292 QRHKGKIKNDKIMRWKIELSCYSFDIIYRPGKENIPPDTL---SRATCATL 339 >SB_24279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 27.9 bits (59), Expect = 3.3 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 234 ERERG-ITIDXIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 383 +R +G I D I WK E S Y II PG + + + S+A CA L Sbjct: 758 QRHKGKIKNDKIMRWKIELSCYSFDIIYRPGKENIPPDTL---SRATCATL 805 >SB_22769| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-07) Length = 203 Score = 27.5 bits (58), Expect = 4.4 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 12/58 (20%) Frame = +3 Query: 219 DKLKAERERGITIDX------IALWKF------ETSKYYVTIIDAPGHRDFIKNMITG 356 DK +ERGIT+D +AL + E +T++D PGH IK +I G Sbjct: 65 DKNPQSQERGITLDLGFSSFQVALPEHLRSAGSEHDLLQMTLVDCPGHASLIKTIIGG 122 Score = 26.6 bits (56), Expect = 7.7 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 35 KMGKEKTHINIVVIGHVDSGKST 103 K+ + + NI V+GHVDSGK++ Sbjct: 28 KIKERILNFNIGVLGHVDSGKTS 50 >SB_9796| Best HMM Match : uDENN (HMM E-Value=1.1e-35) Length = 300 Score = 27.1 bits (57), Expect = 5.8 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -3 Query: 285 FRTSREQYXRL*YHA-HAQPLVCPIPKHI*RILYPFP-GPPSRTSRW 151 F T+ Y + YHA L P+ +I +LY P PP RT R+ Sbjct: 199 FITAAMSYLQQIYHAAKTADLPLPLESYIYNLLYEVPLPPPGRTMRF 245 >SB_1541| Best HMM Match : MMR_HSR1 (HMM E-Value=0.12) Length = 347 Score = 27.1 bits (57), Expect = 5.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 59 INIVVIGHVDSGKSTTTGHLIY 124 + + V+G+VD+GKST G L + Sbjct: 230 VRVAVVGNVDAGKSTLLGVLTH 251 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 26.6 bits (56), Expect = 7.7 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = -2 Query: 196 DPLPIS-----WASFSNFSMVRLSIPPPFVDQVTSGGG 98 +P+P S WA+F +F+ + ++ P V V GGG Sbjct: 735 EPVPASETDTGWANFDSFTDIGMAASNPVVAVVVGGGG 772 >SB_9892| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0013) Length = 663 Score = 26.6 bits (56), Expect = 7.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 156 EKFEKEAQEMGKGSFKYAWVLDKLKAERE 242 +++ K +EM + K W +KLKAE E Sbjct: 42 KEYSKLKEEMNSDAVKVKWAQNKLKAELE 70 >SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26) Length = 541 Score = 26.6 bits (56), Expect = 7.7 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 309 IDAPGHRDFIKNMITGTSQADCAVLIV 389 +D PGH + M+ G + D A+L++ Sbjct: 69 VDCPGHDILMATMLNGAAVMDAALLLI 95 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,523,449 Number of Sequences: 59808 Number of extensions: 205106 Number of successful extensions: 486 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 727815563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -