BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30576 (404 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormo... 23 4.2 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 4.2 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 22 7.4 >DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormone II protein. Length = 113 Score = 23.0 bits (47), Expect = 4.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 334 SSRT*SQEPLRLIALCSSXLPVP 402 SSR + + L+ALC+ LPVP Sbjct: 6 SSRHLAAKLFLLVALCAVLLPVP 28 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.0 bits (47), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 273 WKFETSKYYVTIIDAPG 323 W +E K+ T+I+ PG Sbjct: 487 WNYEDYKFRTTVINMPG 503 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 22.2 bits (45), Expect = 7.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 144 KRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 239 KR I +FE E + K+ D LKAER Sbjct: 319 KRKIGEFEVERDQAAGILAKHDETYDALKAER 350 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 390,812 Number of Sequences: 2352 Number of extensions: 7027 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32494788 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -