BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30574 (337 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L06419-1|AAA60116.1| 727|Homo sapiens lysyl hydroxylase protein. 29 2.7 BC016657-1|AAH16657.1| 727|Homo sapiens procollagen-lysine 1, 2... 29 2.7 AL096840-6|CAC19722.1| 727|Homo sapiens procollagen-lysine 1, 2... 29 2.7 AF490527-1|AAM12752.1| 727|Homo sapiens lysyl hydroxylase protein. 29 2.7 >L06419-1|AAA60116.1| 727|Homo sapiens lysyl hydroxylase protein. Length = 727 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 253 MFHNSKLDNNFILCMKIRKTTIDYFMPKMH 164 +FH+SKLD + C IR+ + F+ H Sbjct: 471 LFHHSKLDPDMAFCANIRQQDVFMFLTNRH 500 >BC016657-1|AAH16657.1| 727|Homo sapiens procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1 protein. Length = 727 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 253 MFHNSKLDNNFILCMKIRKTTIDYFMPKMH 164 +FH+SKLD + C IR+ + F+ H Sbjct: 471 LFHHSKLDPDMAFCANIRQQDVFMFLTNRH 500 >AL096840-6|CAC19722.1| 727|Homo sapiens procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1 protein. Length = 727 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 253 MFHNSKLDNNFILCMKIRKTTIDYFMPKMH 164 +FH+SKLD + C IR+ + F+ H Sbjct: 471 LFHHSKLDPDMAFCANIRQQDVFMFLTNRH 500 >AF490527-1|AAM12752.1| 727|Homo sapiens lysyl hydroxylase protein. Length = 727 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 253 MFHNSKLDNNFILCMKIRKTTIDYFMPKMH 164 +FH+SKLD + C IR+ + F+ H Sbjct: 471 LFHHSKLDPDMAFCANIRQQDVFMFLTNRH 500 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,087,175 Number of Sequences: 237096 Number of extensions: 805543 Number of successful extensions: 810 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 1794632842 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -