BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30570 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosa... 27 2.2 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 25 6.7 SPCC1183.05c |lig4||DNA ligase Lig4|Schizosaccharomyces pombe|ch... 25 8.9 >SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 738 Score = 26.6 bits (56), Expect = 2.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -1 Query: 144 KLYDALTNSIKWCTKLIHSIE*ARKCLLD*NELMHSER 31 K D N IK C + + ++CL D N MH ++ Sbjct: 85 KSVDREQNRIKECLLFVRQVRDFKECLQDLNRAMHHQQ 122 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 25.0 bits (52), Expect = 6.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 209 LHLLECPYLLFYLPHRIIVLIL 144 LH + C Y+ +PH+ I IL Sbjct: 850 LHQVTCSYISIRIPHKFIPFIL 871 >SPCC1183.05c |lig4||DNA ligase Lig4|Schizosaccharomyces pombe|chr 3|||Manual Length = 923 Score = 24.6 bits (51), Expect = 8.9 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -1 Query: 219 LYSITPFGVSVFVILFTSSNHSSYSKLY 136 L ++ P+G S+ I SS+HSSYS Y Sbjct: 363 LETVIPYG-SLRSIFEDSSSHSSYSPYY 389 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,658,422 Number of Sequences: 5004 Number of extensions: 27774 Number of successful extensions: 61 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -