BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30566 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 22 2.8 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 6.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.6 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 22.2 bits (45), Expect = 2.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 131 WVCPCDGGSRSINHQDFYYLPFYS 60 W+C + S ++FYYLP S Sbjct: 49 WICALVNYNVSEISENFYYLPAMS 72 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 6.5 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 121 LATEDRGR*IIRTFIICHFIQNLLLESKNY 32 LA + + ++ T + F+QNL+L+ Y Sbjct: 149 LAVKTTSKSLVPTPVTHIFLQNLILKENTY 178 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 435 VLLAIYSKYT*SRTSWRLTVRSIVTTP 515 +LL IYS + + SW ++V P Sbjct: 1017 LLLVIYSVFNMNNVSWGTREVTVVPKP 1043 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 435 VLLAIYSKYT*SRTSWRLTVRSIVTTP 515 +LL IYS + + SW ++V P Sbjct: 1017 LLLVIYSVFNMNNVSWGTREVTVVPKP 1043 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,161 Number of Sequences: 336 Number of extensions: 2496 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -