BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30564 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 26 0.23 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 0.70 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 4.9 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 6.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.8 bits (54), Expect = 0.23 Identities = 16/57 (28%), Positives = 21/57 (36%) Frame = +1 Query: 118 SRTRSVWTSSPTN*KRPVFSPRTLTENPTRFRENWPSLKTNSKSPKTVSSLVTLRSQ 288 S T S W ++ T + P T + NWP+ T P V V SQ Sbjct: 1045 STTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNWPTQGTTIPPPAVVMPEVDKPSQ 1101 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 24.2 bits (50), Expect = 0.70 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = +3 Query: 6 TSXKSEERSGTAQQKLLEAQQSADENNRMCKVLENRAQQDEERMDQLTNQLKE 164 TS K++E G K ++ EN+ K+ +DE+ +N KE Sbjct: 853 TSDKAQEADGEVVVKKEVDEEERLENHTSVKIKREAEDRDEDERSFHSNGAKE 905 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.4 bits (43), Expect = 4.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 316 PTTFNSSSSSEILASPD 266 P F ++SSS L SPD Sbjct: 216 PAEFPTTSSSSALESPD 232 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 6.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 352 FSSDTSRDLRELPTTFNS 299 F D RDL E+ +FNS Sbjct: 86 FQGDIHRDLTEVYFSFNS 103 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,627 Number of Sequences: 336 Number of extensions: 1333 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -