BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30562 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39960.1 68415.m04910 microsomal signal peptidase 25 kDa subu... 39 0.002 At1g51870.1 68414.m05847 protein kinase family protein contains ... 30 1.1 At1g51860.1 68414.m05846 leucine-rich repeat protein kinase, put... 30 1.1 At5g38460.1 68418.m04649 ALG6, ALG8 glycosyltransferase family p... 29 2.5 At1g08150.1 68414.m00898 sodium/hydrogen exchanger family protei... 29 2.5 At1g51890.1 68414.m05849 leucine-rich repeat protein kinase, put... 28 3.2 At1g51880.1 68414.m05848 leucine-rich repeat protein kinase, put... 28 3.2 At5g59650.1 68418.m07479 leucine-rich repeat protein kinase, put... 28 4.3 At3g21340.1 68416.m02695 leucine-rich repeat protein kinase, put... 28 4.3 At1g51850.1 68414.m05845 leucine-rich repeat protein kinase, put... 28 4.3 At1g51805.1 68414.m05838 leucine-rich repeat protein kinase, put... 27 5.7 At2g37050.1 68415.m04546 leucine-rich repeat family protein / pr... 27 7.5 At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, put... 27 9.9 At1g62540.1 68414.m07056 flavin-containing monooxygenase family ... 27 9.9 >At2g39960.1 68415.m04910 microsomal signal peptidase 25 kDa subunit, putative (SPC25) identical to Probable microsomal signal peptidase 25 kDa subunit (EC 3.4.-.-) (SPase 25 kDa subunit) (SPC25) (Swiss-Prot:P58684) [Arabidopsis thaliana]; contains non-consensus AT-AC splice sites; contains 1 transmembrane domain; Length = 192 Score = 38.7 bits (86), Expect = 0.002 Identities = 36/147 (24%), Positives = 59/147 (40%), Gaps = 1/147 (0%) Frame = +3 Query: 75 SETAEAAKINKWDGAAAKNAVDDAIREVMTGDLKCKESFALIDGRLFXXXXXXXXXXXXX 254 S K N D + K+ +D+++ +++T KE L + +L Sbjct: 8 STNKNVKKANLLDHHSIKHILDESVSDIVTSR-GYKEDVRLSNLKLILGTIIIVVALVAQ 66 Query: 255 XWDYLYPFPQSRLVLIICVSSYFILMGILTLYTTFKEKGIFVVAXEKVGNNTRV-WEASS 431 Y FP++R LI C++ Y +L +L L KEK + G+ T SS Sbjct: 67 F--YNKKFPENRDFLIGCIALYVVLNAVLQLILYTKEKNAILFTYPPEGSFTSTGLVVSS 124 Query: 432 YVKKHDDKYNLVIVMRDTNGNTREASV 512 + + D+Y L I D + SV Sbjct: 125 KLPRFSDQYTLTIDSADPKSISAGKSV 151 >At1g51870.1 68414.m05847 protein kinase family protein contains Serine/Threonine protein kinases active-site signature, PROSITE:PS00108 Length = 837 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 236 CGPLRTAMGLSLSIPSIKTGSNHLRVIIFHTDGYFDPLHY 355 CG GLS S P G H+ ++ T GY DP +Y Sbjct: 667 CGAKLADFGLSRSFPI--DGECHVSTVVAGTPGYLDPEYY 704 >At1g51860.1 68414.m05846 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 890 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 236 CGPLRTAMGLSLSIPSIKTGSNHLRVIIFHTDGYFDPLHY 355 CG GLS S P G H+ ++ T GY DP +Y Sbjct: 720 CGAKLADFGLSRSFPI--DGECHVSTVVAGTPGYLDPEYY 757 >At5g38460.1 68418.m04649 ALG6, ALG8 glycosyltransferase family protein similar to SP|Q9Y672 Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase (EC 2.4.1.-) (Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase) {Homo sapiens}; contains Pfam profile PF03155: ALG6, ALG8 glycosyltransferase family Length = 533 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 270 YPFPQSRLVLIICVSSYFILMGILTLYT 353 YPF L++I+C SYFI+ T YT Sbjct: 489 YPFLFEALIMILCF-SYFIMFAFYTNYT 515 >At1g08150.1 68414.m00898 sodium/hydrogen exchanger family protein contains InterPro entry IPR006153: Sodium/hydrogen exchanger Length = 815 Score = 28.7 bits (61), Expect = 2.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 258 WDYLYPFPQSRLVLIICVSSYFIL 329 WDY P +S +VL++C+ +F L Sbjct: 61 WDYSLPHLESVIVLVLCLWQFFYL 84 >At1g51890.1 68414.m05849 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 888 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 260 GLSLSIPSIKTGSNHLRVIIFHTDGYFDPLHY 355 GLS S P G +H+ ++ T GY DP +Y Sbjct: 726 GLSRSFPV--DGESHVMTVVAGTPGYLDPEYY 755 >At1g51880.1 68414.m05848 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 880 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 260 GLSLSIPSIKTGSNHLRVIIFHTDGYFDPLHY 355 GLS S P G +H+ ++ T GY DP +Y Sbjct: 718 GLSRSFPV--DGESHVSTVVAGTPGYLDPEYY 747 >At5g59650.1 68418.m07479 leucine-rich repeat protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 892 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 260 GLSLSIPSIKTGSNHLRVIIFHTDGYFDPLHY 355 GLS S P G H+ ++ T GY DP +Y Sbjct: 732 GLSRSFPI--GGETHISTVVAGTPGYLDPEYY 761 >At3g21340.1 68416.m02695 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 880 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 260 GLSLSIPSIKTGSNHLRVIIFHTDGYFDPLHY 355 GLS S P G H+ ++ T GY DP +Y Sbjct: 718 GLSRSFPI--EGETHVSTVVAGTPGYLDPEYY 747 >At1g51850.1 68414.m05845 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376 Length = 865 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 260 GLSLSIPSIKTGSNHLRVIIFHTDGYFDPLHY 355 GLS S P G H+ ++ T GY DP +Y Sbjct: 703 GLSRSFPI--EGETHVSTVVAGTPGYLDPEYY 732 >At1g51805.1 68414.m05838 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 260 GLSLSIPSIKTGSNHLRVIIFHTDGYFDPLHY 355 GLS S P G H+ ++ T GY DP +Y Sbjct: 722 GLSRSFPI--GGETHVSTVVAGTPGYLDPEYY 751 >At2g37050.1 68415.m04546 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 934 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 293 GSNHLRVIIFHTDGYFDPLHYIQRE 367 G++H+ I+ T GY DP +YI ++ Sbjct: 758 GTSHVSSIVRGTVGYLDPEYYISQQ 782 >At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 786 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 260 GLSLSIPSIKTGSNHLRVIIFHTDGYFDPLHY 355 GLS S P+ H+ ++ T GY DP +Y Sbjct: 624 GLSRSFPT--ENETHVSTVVAGTPGYLDPEYY 653 >At1g62540.1 68414.m07056 flavin-containing monooxygenase family protein / FMO family protein similar to flavin-containing monooxygenase GB:AAA21178 GI:349534 from Oryctolagus cuniculus [SP|P32417], SP|P97501 from Mus musculus; contains Pfam profile PF00743 Flavin-binding monooxygenase-like Length = 457 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 372 IFVVAXEKVGNNTRVWEASSYVKKHDDKYNLVIV 473 I VV E V RVW +S HD+ ++ V+V Sbjct: 134 IEVVRVEPVNGKWRVWSKTSGGVSHDEIFDAVVV 167 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,693,850 Number of Sequences: 28952 Number of extensions: 204940 Number of successful extensions: 481 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -