BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30556 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 29 0.12 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 26 0.87 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 25 1.1 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 1.5 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 24 3.5 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 6.1 EF519407-1|ABP68516.1| 157|Anopheles gambiae ENSANGG00000008286... 23 6.1 EF519406-1|ABP68515.1| 164|Anopheles gambiae ENSANGG00000008286... 23 6.1 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 8.1 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 8.1 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 8.1 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 8.1 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 8.1 AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. 23 8.1 AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. 23 8.1 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 8.1 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 28.7 bits (61), Expect = 0.12 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 365 VAQGSFSWTSPEGVPISVNYVAD-ENGY 445 V QGS+S P+G +V+Y AD NG+ Sbjct: 48 VVQGSYSVVDPDGTKRTVDYTADPHNGF 75 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 25.8 bits (54), Expect = 0.87 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 369 HRAHSPGHLLKVFPSASITSPTRT 440 HR PGH+ + P S +PT T Sbjct: 205 HRCRKPGHMKRDCPMESNNTPTST 228 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.4 bits (53), Expect = 1.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 241 FDSLSAVTLRYLGYYSDGGNRGDRDGQKRSR 149 + + S +L L Y DGG G D KR+R Sbjct: 900 YSNSSINSLNSLDNYGDGGEAGTGDSGKRAR 930 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 113 TGMGSSCRIHFHTGLGRQPLPP 48 TGM S R F G+G P PP Sbjct: 766 TGMPSPSRSAFADGIGSPPPPP 787 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.0 bits (52), Expect = 1.5 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -1 Query: 402 PSGDVQENEPCATTGTAGGFPPRLRGTP 319 P GD Q + P + GG PP TP Sbjct: 324 PMGDPQTSRPPSGNDNMGGGPPPSSATP 351 Score = 22.6 bits (46), Expect = 8.1 Identities = 19/63 (30%), Positives = 26/63 (41%) Frame = +2 Query: 305 AAQEQGVPRNLGGNPPAVPVVAQGSFSWTSPEGVPISVNYVADENGYQPTGNAIPTSPPV 484 +AQ P +G PP P G P+ P + N +G P+G P PP+ Sbjct: 250 SAQGMQRPPMMGQPPPIRPPNPMGG---PRPQISPQNSNL----SGGMPSGMVGPPRPPM 302 Query: 485 PEQ 493 P Q Sbjct: 303 PMQ 305 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.8 bits (49), Expect = 3.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 398 QEMSRRMSPVQRREQQGGFHQGYVELP 318 Q+ ++ +QRR+QQ HQG +P Sbjct: 264 QQPQQKQQQLQRRQQQQQQHQGQRYVP 290 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.0 bits (47), Expect = 6.1 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -3 Query: 490 LRHWWGSGDS 461 LRHWW +G++ Sbjct: 412 LRHWWDNGNN 421 >EF519407-1|ABP68516.1| 157|Anopheles gambiae ENSANGG00000008286-like protein. Length = 157 Score = 23.0 bits (47), Expect = 6.1 Identities = 14/63 (22%), Positives = 30/63 (47%) Frame = +3 Query: 318 REFHVTLVETPLLFPSLHRAHSPGHLLKVFPSASITSPTRTDTSPLVMLSPLPHQCLSRS 497 ++FH ++ + LL R H P + + + +T PLVM+ P+ +++ Sbjct: 34 KQFH-SITDQGLLL-DFFRQHFPDAIELIGRERLVKDFFKTKAQPLVMIKCRPYHIGAKA 91 Query: 498 LVL 506 L++ Sbjct: 92 LII 94 >EF519406-1|ABP68515.1| 164|Anopheles gambiae ENSANGG00000008286-like protein. Length = 164 Score = 23.0 bits (47), Expect = 6.1 Identities = 14/63 (22%), Positives = 30/63 (47%) Frame = +3 Query: 318 REFHVTLVETPLLFPSLHRAHSPGHLLKVFPSASITSPTRTDTSPLVMLSPLPHQCLSRS 497 ++FH ++ + LL R H P + + + +T PLVM+ P+ +++ Sbjct: 53 KQFH-SITDQGLLL-DFFRQHFPDAIELIGRERLVKDFFKTKAQPLVMIKCRPYHIGAKA 110 Query: 498 LVL 506 L++ Sbjct: 111 LII 113 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +3 Query: 411 SASITSPTRTDTSPLVMLSPL 473 +++ +SPTR + S +V +SPL Sbjct: 54 ASAASSPTRDEMSVVVPISPL 74 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +3 Query: 411 SASITSPTRTDTSPLVMLSPL 473 +++ +SPTR + S +V +SPL Sbjct: 54 ASAASSPTRDEMSVVVPISPL 74 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 190 GGNRGDRDGQKRSRSGHGNERPV 122 GGNRG G + R+ +GN V Sbjct: 409 GGNRGAGGGWRSERTCNGNNDTV 431 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 363 SLHRAHSPGHLLKVFPSASITSPTRTD 443 S + H H + PS+ ++SP TD Sbjct: 472 SRYEHHLSRHASSILPSSLVSSPDGTD 498 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 363 SLHRAHSPGHLLKVFPSASITSPTRTD 443 S + H H + PS+ ++SP TD Sbjct: 448 SRYEHHLSRHASSILPSSLVSSPDGTD 474 >AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -3 Query: 214 RYLGYYSDGGNRGDRDGQKRSRSGH 140 +YL Y+ GG G+ RS H Sbjct: 62 QYLDYFDFGGGSAGELGENRSLHAH 86 >AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -3 Query: 214 RYLGYYSDGGNRGDRDGQKRSRSGH 140 +YL Y+ GG G+ RS H Sbjct: 62 QYLDYFDFGGGSAGELGENRSLHAH 86 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 393 DVQENEPCATTGTAGGFPP 337 DV+E+EP A G +GG P Sbjct: 194 DVKEDEPGAGGGGSGGGAP 212 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 551,906 Number of Sequences: 2352 Number of extensions: 12630 Number of successful extensions: 64 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -