BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30554 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 24 3.5 AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse t... 24 3.5 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 23.8 bits (49), Expect = 3.5 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = -1 Query: 504 IQKFRSFIYRLRHDEACLVR*LFIKMTFF 418 + +++ F+Y D CL+R + I + F+ Sbjct: 56 LDQYKKFVYPPDRDTMCLIRCIGISLDFW 84 >AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse transcriptase protein. Length = 131 Score = 23.8 bits (49), Expect = 3.5 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 269 FP*VIQKLKLNCITDITITKTINYFEDRRSVTND 168 F V+Q LNC + T+ +F RRSVT + Sbjct: 15 FEVVVQNSLLNCCRSLISTRQHGFF-PRRSVTTN 47 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 421,267 Number of Sequences: 2352 Number of extensions: 7185 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -