BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30552 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0520 + 3761990-3762327,3763304-3763589,3763746-3763820,376... 29 2.9 01_01_0092 + 722744-723459,723542-723711,723792-724885 29 2.9 04_04_0964 - 29749624-29749649,29749742-29749945,29750036-297506... 27 6.8 05_03_0070 - 8023343-8023528,8023606-8023639,8024013-8024058,802... 27 8.9 03_06_0352 - 33312443-33312652,33312747-33312854,33313224-333133... 27 8.9 >06_01_0520 + 3761990-3762327,3763304-3763589,3763746-3763820, 3764013-3764961,3766967-3767064,3768144-3768284, 3768758-3768874,3768924-3769013,3769014-3771818 Length = 1632 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 141 HVPMAEPFAI-QSVCSFVEADPHFCGHRAKN 230 HVPM EP I S C V AD G KN Sbjct: 1336 HVPMQEPLRIASSCCEIVNADQVCAGEVGKN 1366 >01_01_0092 + 722744-723459,723542-723711,723792-724885 Length = 659 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 118 VSITDDQFTFPWLNLSPFSLFAPLWKLIPTFVDIGPRIY 234 +S + +F NL S PLW +P F D+G ++Y Sbjct: 92 ISYNESRFWVVDANLDNSSCPLPLWNNLPYFNDMGTKLY 130 >04_04_0964 - 29749624-29749649,29749742-29749945,29750036-29750634, 29750742-29750826,29750914-29751562,29751568-29751643, 29753891-29753957,29754097-29754998,29756579-29756790 Length = 939 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 358 HDVFASQFFHTYSLPVNSSAADVTAELTSD 447 HD F + H S+P+ A V AE++ D Sbjct: 809 HDSFLRSYLHLTSMPLPCEGAAVPAEISKD 838 >05_03_0070 - 8023343-8023528,8023606-8023639,8024013-8024058, 8024139-8024389,8024473-8026001,8026128-8026496, 8026582-8026821 Length = 884 Score = 27.1 bits (57), Expect = 8.9 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = -1 Query: 210 KSGDQLPQRSKQTEWRKVQPWERELVICNGDGLRDNFFVPGRQSRYRCETGESDENRKE 34 K G+ P+RSKQ +KV P + + V N G + + R ++ + GE NRK+ Sbjct: 78 KEGEMAPRRSKQEPKKKV-PSKDDDVPANTTGTKKS----ERSAKAKKRKGERSVNRKD 131 >03_06_0352 - 33312443-33312652,33312747-33312854,33313224-33313397, 33313489-33313695,33313700-33313987,33314087-33314319, 33314450-33315263 Length = 677 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -2 Query: 449 PSEVSSAVTSAALEFTGRL*VWKNWLANTSWSSSLAS 339 P E+ + SAA F R+ V K+W+ +T SS++ + Sbjct: 403 PVELFIGILSAANHFAERMAVRKSWMIDTRKSSNVVA 439 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,613,791 Number of Sequences: 37544 Number of extensions: 194465 Number of successful extensions: 653 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -