BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30552 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 31 0.56 SB_12805| Best HMM Match : LicD (HMM E-Value=9.7e-06) 29 1.7 SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) 29 3.0 SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) 28 4.0 SB_51159| Best HMM Match : DUF1140 (HMM E-Value=2.3) 28 5.3 SB_41830| Best HMM Match : S4 (HMM E-Value=1.6e-12) 28 5.3 SB_24780| Best HMM Match : Linker_histone (HMM E-Value=0.0023) 27 9.2 SB_1788| Best HMM Match : Linker_histone (HMM E-Value=0.0023) 27 9.2 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 31.1 bits (67), Expect = 0.56 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +1 Query: 319 IFVQGSQEAKEDDHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTA 468 I + G ++ E +H S+F +Y+LP + V++ +T DG L + A Sbjct: 64 IKIDGKHKS-EGEHGYETSEFHRSYNLPDGVDVSTVSSRITGDGLLHIEA 112 >SB_12805| Best HMM Match : LicD (HMM E-Value=9.7e-06) Length = 371 Score = 29.5 bits (63), Expect = 1.7 Identities = 20/62 (32%), Positives = 26/62 (41%) Frame = -2 Query: 230 ILGPMSTKVGISFHKGANRLNGERFSHGNVNWSSVMETGCAITSLSRAGKAVTVAKPAKA 51 I+GP+ K G F R G F NW V+ T T +S A + V +PA Sbjct: 217 IMGPLWFKHGDIFPVARLRFEGFMFDVPR-NWKQVLRTLYGRTGISAAVPTLMVVEPAPT 275 Query: 50 MK 45 K Sbjct: 276 QK 277 >SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) Length = 405 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -1 Query: 237 SVDSWPDVHKSGDQLPQRSKQTEWRKVQPWEREL--VICNGDGLRD 106 +V S+ + KSG +P R++ T +R PW +E+ ++C D L + Sbjct: 135 AVSSYRFLCKSGHYIPLRTRSTLFR--NPWTKEIEFLVCTNDVLTE 178 >SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) Length = 1035 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 331 GSQEAKEDDHDVFASQFFHTYSLPVNSSAA 420 G+ +E+D DV+A Y +P N SAA Sbjct: 245 GTGVFEEEDDDVYAQDIMSNYDIPKNISAA 274 >SB_51159| Best HMM Match : DUF1140 (HMM E-Value=2.3) Length = 444 Score = 27.9 bits (59), Expect = 5.3 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 109 AQPVSITDDQFTFPWLNLSPFSLFAPLWKLIPTFVDIGP 225 + P + T DQ + + + SPFS APL P FVD P Sbjct: 219 SSPETFTSDQLSPTYSSPSPFSSKAPL----PVFVDFTP 253 >SB_41830| Best HMM Match : S4 (HMM E-Value=1.6e-12) Length = 275 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 230 ILGPMSTKVGISFHKGANRLNGERFSH 150 + G T+VGI H G NR+ + F H Sbjct: 209 VAGEKKTEVGIKIHSGRNRIVRKIFEH 235 >SB_24780| Best HMM Match : Linker_histone (HMM E-Value=0.0023) Length = 186 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 134 SSVMETGCAITSLSRAGKAVTVAKPAKAMKTAKRRG 27 S ++TG A+ K V VAKPA+ AKR+G Sbjct: 73 SRAVKTG-ALVKNGAYFKVVVVAKPARKRSAAKRKG 107 >SB_1788| Best HMM Match : Linker_histone (HMM E-Value=0.0023) Length = 186 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 134 SSVMETGCAITSLSRAGKAVTVAKPAKAMKTAKRRG 27 S ++TG A+ K V VAKPA+ AKR+G Sbjct: 73 SRAVKTG-ALVKNGAYFKVVVVAKPARKRSAAKRKG 107 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,207,257 Number of Sequences: 59808 Number of extensions: 220239 Number of successful extensions: 651 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -