BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30551 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38727| Best HMM Match : 7tm_1 (HMM E-Value=9.2e-30) 30 0.98 SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) 27 6.9 SB_24118| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_38727| Best HMM Match : 7tm_1 (HMM E-Value=9.2e-30) Length = 420 Score = 30.3 bits (65), Expect = 0.98 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 19 VFLAICLSLTVALAAETGKYTPFQYNPSLLYCF 117 VFL +S+TV + + GKY P YN +++ F Sbjct: 132 VFLVWGISITVGVLSVVGKYEPLAYNVTVIALF 164 >SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) Length = 1353 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/74 (22%), Positives = 26/74 (35%) Frame = +3 Query: 294 PEEPYVRDQGGPQQNTLGDAYKGIQXCXXCPFVKPXHFPCQSXPHTXCQXRGXTPHIRWP 473 P++ V Q P+Q++ + Q KP H H C+ P + Sbjct: 851 PQDKQVARQARPRQSSRKSKARPRQASRKTKTSKPQHKQASRPRHASCKTMASKPQDQDK 910 Query: 474 XRVGPXQRRRATTT 515 P Q+ R T T Sbjct: 911 QSTRPGQKSRKTRT 924 >SB_24118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -3 Query: 115 NSRVNSGCTGKECTFQFRRPAPLSETGRLPKRHAFP 8 N+R + T F +PAP S K +AFP Sbjct: 779 NNRTTASVTATRPAFNGNKPAPTSRNNASDKANAFP 814 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,380,088 Number of Sequences: 59808 Number of extensions: 282916 Number of successful extensions: 853 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -