BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30550 (388 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55061| Best HMM Match : Defensin_beta (HMM E-Value=6.9) 37 0.007 SB_55701| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.012 SB_18297| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.062 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.25 SB_48656| Best HMM Match : Extensin_2 (HMM E-Value=0.0009) 30 0.57 SB_43996| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.76 SB_19076| Best HMM Match : HECT (HMM E-Value=0) 29 1.8 SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08) 29 1.8 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 28 2.3 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 28 3.1 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_23827| Best HMM Match : DUF809 (HMM E-Value=9.1) 27 4.0 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 27 4.0 SB_56086| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 27 4.0 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 23 7.0 SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17) 27 7.1 SB_34419| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 27 7.1 SB_56167| Best HMM Match : Plasmodium_HRP (HMM E-Value=6.8) 27 7.1 SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_59425| Best HMM Match : Adeno_VII (HMM E-Value=4.5) 26 9.3 SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_56071| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_54349| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_30752| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_1818| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_52546| Best HMM Match : ResIII (HMM E-Value=0.21) 26 9.3 SB_26236| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_25066| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_21268| Best HMM Match : DnaJ_CXXCXGXG (HMM E-Value=3.7) 26 9.3 SB_9042| Best HMM Match : TNFR_c6 (HMM E-Value=7.8) 26 9.3 >SB_55061| Best HMM Match : Defensin_beta (HMM E-Value=6.9) Length = 350 Score = 36.7 bits (81), Expect = 0.007 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+S PNP+S P P+ Sbjct: 31 PNPDSCYPNPDSCYPNPDSCYPNPD 55 Score = 36.7 bits (81), Expect = 0.007 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+S PNP+S P P+ Sbjct: 199 PNPDSCYPNPDSCYPNPDSCYPNPD 223 Score = 34.3 bits (75), Expect = 0.035 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+S PNP+S P P+ Sbjct: 24 PNPDYCYPNPDSCYPNPDSCYPNPD 48 Score = 34.3 bits (75), Expect = 0.035 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+S PNP+ P P+ Sbjct: 157 PNPDSCYPNPDSCYPNPDYCYPNPD 181 Score = 33.9 bits (74), Expect = 0.047 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+S PNP+ P P+ Sbjct: 38 PNPDSCYPNPDSCYPNPDYCNPNPD 62 Score = 33.9 bits (74), Expect = 0.047 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+S PNP+S P P+ Sbjct: 150 PNPDYCNPNPDSCYPNPDSCYPNPD 174 Score = 33.9 bits (74), Expect = 0.047 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+S PNP+S P P+ Sbjct: 192 PNPDYCNPNPDSCYPNPDSCYPNPD 216 Score = 33.9 bits (74), Expect = 0.047 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+S PNP+ P P+ Sbjct: 206 PNPDSCYPNPDSCYPNPDYCNPNPD 230 Score = 33.9 bits (74), Expect = 0.047 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+S PNP+ P P+ Sbjct: 234 PNPDSCNPNPDSCYPNPDYCYPNPD 258 Score = 33.5 bits (73), Expect = 0.062 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+S PNP+S P P+ Sbjct: 59 PNPDYCNPNPDSCNPNPDSCYPNPD 83 Score = 33.5 bits (73), Expect = 0.062 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+S PNP+S P P+ Sbjct: 122 PNPDYCNPNPDSCNPNPDSCYPNPD 146 Score = 33.5 bits (73), Expect = 0.062 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+S PNP+ P P+ Sbjct: 129 PNPDSCNPNPDSCYPNPDYCNPNPD 153 Score = 33.5 bits (73), Expect = 0.062 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+S PNP+S P P+ Sbjct: 227 PNPDYCNPNPDSCNPNPDSCYPNPD 251 Score = 33.1 bits (72), Expect = 0.081 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCP 11 PNP+S PNP+S PNP+S P Sbjct: 66 PNPDSCNPNPDSCYPNPDSCYP 87 Score = 31.9 bits (69), Expect = 0.19 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+ PNP+ P P+ Sbjct: 164 PNPDSCYPNPDYCYPNPDFCYPNPD 188 Score = 31.9 bits (69), Expect = 0.19 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+ PNP+ P P+ Sbjct: 241 PNPDSCYPNPDYCYPNPDYCYPNPD 265 Score = 31.5 bits (68), Expect = 0.25 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+S PNP+ P P+ Sbjct: 94 PNPDYCYPNPDSCYPNPDYCNPNPD 118 Score = 31.5 bits (68), Expect = 0.25 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+S P P+ Sbjct: 248 PNPDYCYPNPDYCYPNPDSCNPNPD 272 Score = 31.1 bits (67), Expect = 0.33 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+ PNP+ P P+ Sbjct: 45 PNPDSCYPNPDYCNPNPDYCNPNPD 69 Score = 31.1 bits (67), Expect = 0.33 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+ PNP+ P P+ Sbjct: 101 PNPDSCYPNPDYCNPNPDYCNPNPD 125 Score = 31.1 bits (67), Expect = 0.33 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+ PNP+ P P+ Sbjct: 136 PNPDSCYPNPDYCNPNPDYCNPNPD 160 Score = 31.1 bits (67), Expect = 0.33 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+S P P+ Sbjct: 143 PNPDYCNPNPDYCNPNPDSCYPNPD 167 Score = 31.1 bits (67), Expect = 0.33 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+S P P+ Sbjct: 185 PNPDYCNPNPDYCNPNPDSCYPNPD 209 Score = 31.1 bits (67), Expect = 0.33 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+ PNP+ P P+ Sbjct: 213 PNPDSCYPNPDYCNPNPDYCNPNPD 237 Score = 31.1 bits (67), Expect = 0.33 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+S PNP+ P P+ Sbjct: 255 PNPDYCYPNPDSCNPNPDYCNPNPD 279 Score = 30.7 bits (66), Expect = 0.43 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+S P P+ Sbjct: 52 PNPDYCNPNPDYCNPNPDSCNPNPD 76 Score = 30.7 bits (66), Expect = 0.43 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PNP+S PN + P P+ Sbjct: 73 PNPDSCYPNPDSCYPNHDYCYPNPD 97 Score = 30.7 bits (66), Expect = 0.43 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+S P P+ Sbjct: 115 PNPDYCNPNPDYCNPNPDSCNPNPD 139 Score = 30.7 bits (66), Expect = 0.43 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+S P P+ Sbjct: 220 PNPDYCNPNPDYCNPNPDSCNPNPD 244 Score = 30.7 bits (66), Expect = 0.43 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+S P P+ Sbjct: 304 PNPDYCNPNPDYCNPNPDSCNPNPD 328 Score = 30.3 bits (65), Expect = 0.57 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCP 11 PNP+S PNP+ PNP+S P Sbjct: 262 PNPDSCNPNPDYCNPNPDSCYP 283 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+ P P+ Sbjct: 171 PNPDYCYPNPDFCYPNPDYCNPNPD 195 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPES 20 PNP+ PNP+S PNP+S Sbjct: 311 PNPDYCNPNPDSCNPNPDS 329 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+ P P+ Sbjct: 178 PNPDFCYPNPDYCNPNPDYCNPNPD 202 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+ P P+ Sbjct: 290 PNPDYCNPNPDFCYPNPDYCNPNPD 314 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+ P P+ Sbjct: 297 PNPDFCYPNPDYCNPNPDYCNPNPD 321 Score = 28.3 bits (60), Expect = 2.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PN + PNP+ P P+ Sbjct: 80 PNPDSCYPNHDYCYPNPDYCYPNPD 104 Score = 28.3 bits (60), Expect = 2.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PN + PNP+ PNP+S P P+ Sbjct: 87 PNHDYCYPNPDYCYPNPDSCYPNPD 111 Score = 28.3 bits (60), Expect = 2.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+ PNP+ P P+ Sbjct: 108 PNPDYCNPNPDYCNPNPDYCNPNPD 132 Score = 27.5 bits (58), Expect = 4.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+ PNP+S PN + P P+ Sbjct: 269 PNPDYCNPNPDSCYPNHDYCNPNPD 293 Score = 27.5 bits (58), Expect = 4.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESWCPXPE 2 PNP+S PN + PNP+ P P+ Sbjct: 276 PNPDSCYPNHDYCNPNPDYCNPNPD 300 Score = 26.2 bits (55), Expect = 9.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 76 PNPESWCPNPESWCPNPESW 17 PNP+S PNP+S SW Sbjct: 318 PNPDSCNPNPDSGSVGKASW 337 >SB_55701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.012 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 88 SPKLPNPESWCPNPESWCPNPESWCPXP 5 S ++P+P W P+P W +P W P P Sbjct: 27 SVRIPDPRVWIPDPSMWILDPSVWIPDP 54 >SB_18297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 33.5 bits (73), Expect = 0.062 Identities = 12/33 (36%), Positives = 26/33 (78%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 R +SH++ R++S G +++SHG ++++HG + +S Sbjct: 55 RVKSHEN-RVKSHGNRVKSHGNRVKSHGNRVKS 86 Score = 32.3 bits (70), Expect = 0.14 Identities = 11/28 (39%), Positives = 23/28 (82%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHG 16 R +SH++ R++S G +++SHG ++++HG Sbjct: 118 RVKSHEN-RVKSHGNRVKSHGNRVKSHG 144 Score = 31.9 bits (69), Expect = 0.19 Identities = 12/33 (36%), Positives = 25/33 (75%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 R +SH + R++S G +++SHG ++++HG + +S Sbjct: 6 RVKSHGN-RVKSHGNRVKSHGNRVKSHGNRVKS 37 Score = 31.9 bits (69), Expect = 0.19 Identities = 12/33 (36%), Positives = 25/33 (75%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 R +SH + R++S G +++SHG ++++HG + +S Sbjct: 13 RVKSHGN-RVKSHGNRVKSHGNRVKSHGNRVKS 44 Score = 31.9 bits (69), Expect = 0.19 Identities = 12/33 (36%), Positives = 25/33 (75%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 R +SH + R++S G +++SHG ++++HG + +S Sbjct: 20 RVKSHGN-RVKSHGNRVKSHGNRVKSHGNRVKS 51 Score = 30.3 bits (65), Expect = 0.57 Identities = 11/33 (33%), Positives = 25/33 (75%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 R +SH++ R++S +++SHG ++++HG + +S Sbjct: 111 RVKSHEN-RVKSHENRVKSHGNRVKSHGNRVKS 142 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/33 (33%), Positives = 24/33 (72%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 R +SH + R++S G +++SH ++++HG + +S Sbjct: 69 RVKSHGN-RVKSHGNRVKSHENRVKSHGNRVKS 100 Score = 27.5 bits (58), Expect = 4.0 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHG 16 R +SH + R++S G ++ HG ++++HG Sbjct: 132 RVKSHGN-RVKSHGNRVTCHGNRVKSHG 158 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 31.5 bits (68), Expect = 0.25 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -2 Query: 114 LCQNCRARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 +C R SH S +++S GVQ++S GVQ ++ GVQ +S Sbjct: 80 VCSGKRHTSHYS-QLQSLGVQLQSLGVQPQSLGVQPQS 116 Score = 26.2 bits (55), Expect = 9.3 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = -2 Query: 75 RIRSRGVQIRSHGVQIRNHGVQXRS 1 +++S GVQ +S GVQ+++ GVQ +S Sbjct: 127 QLQSLGVQPQSLGVQLQSLGVQPQS 151 >SB_48656| Best HMM Match : Extensin_2 (HMM E-Value=0.0009) Length = 392 Score = 30.3 bits (65), Expect = 0.57 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -1 Query: 124 PALSLPKLSSAESPKLPNPESWCPNPESWCPNPESWCPXPE 2 P LP+L+ + P P+ P P+ P P+ P P+ Sbjct: 187 PQAPLPQLAPLPKQQAPLPQQQAPLPQQQAPLPQQQAPLPQ 227 >SB_43996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1056 Score = 29.9 bits (64), Expect = 0.76 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 3/95 (3%) Frame = -1 Query: 277 QCLRPFAIFEVRAPPMAVPIPPNEVAMPSRPFSILSSSIPWSAKLEISFTCPALSLPKLS 98 +C P ++ A + P P + P S+P E S P S P Sbjct: 726 RCDLPLLSTKIGALKHSQPSPEHSQPSPEHSLPSQEHSLP---SPEHSQPSPEHSQPSPE 782 Query: 97 SAE-SPK--LPNPESWCPNPESWCPNPESWCPXPE 2 ++ SP+ P+PE P+PE P+PE P PE Sbjct: 783 HSQPSPEHSQPSPEHSQPSPEHCQPSPEHSQPSPE 817 Score = 27.1 bits (57), Expect = 5.3 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 3/75 (4%) Frame = -1 Query: 217 PPNEVAMPSRPFSILSSSIPWSAKLEISFTCPALSLPKLSSAE-SPK--LPNPESWCPNP 47 P E ++PS+ S+ S + E S P S P ++ SP+ P+PE P+P Sbjct: 751 PSPEHSLPSQEHSLPSPEHSQPSP-EHSQPSPEHSQPSPEHSQPSPEHSQPSPEHCQPSP 809 Query: 46 ESWCPNPESWCPXPE 2 E P+PE P E Sbjct: 810 EHSQPSPEHSLPSQE 824 >SB_19076| Best HMM Match : HECT (HMM E-Value=0) Length = 2018 Score = 28.7 bits (61), Expect = 1.8 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -1 Query: 205 VAMPSRPFSILSSSIPWSAKLEISFTCPALSLPKLSSAES 86 V PS+PFS+++S+I + E F+ L L SSA S Sbjct: 841 VCRPSQPFSLITSNIEATQASEELFSVEPLPLKSPSSATS 880 >SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 620 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 256 IFEVRAPPMAVPIPPNEVAMPSRPFS 179 I +V PP + P PPN A PS FS Sbjct: 268 IQDVTQPPPSTPAPPNTPAPPSGKFS 293 >SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08) Length = 421 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -1 Query: 124 PALSLPKLSSAESPKL-PNPESWCPNPESWCPNPESWCPXP 5 P+L +PK E + P E W P W + +SW P Sbjct: 358 PSLGIPKERGREGGLVTPGAEIWMQTPSIWTRSGDSWRDSP 398 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 28.3 bits (60), Expect = 2.3 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 106 KLSSAESP-KLPNPESWCPNPESWCPNPESWCPXP 5 K+ S +P + P PE+ P PE+ P PE+ P P Sbjct: 141 KIPSPPNPTEAPEPETVPPQPETVPPQPETVPPQP 175 Score = 27.5 bits (58), Expect = 4.0 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -1 Query: 85 PKLPNPESWCPNPESWCPNPESWCPXPE 2 P PNP P PE+ P PE+ P PE Sbjct: 143 PSPPNPTE-APEPETVPPQPETVPPQPE 169 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 28.3 bits (60), Expect = 2.3 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = -1 Query: 214 PNEVAMPSRPFSILSSSIPWSAKLEISFTCPALSLPKLSSAESPKL--PNPESWCPNPES 41 P + PS S S+ P S S T P L S +E+P L PNP S C P S Sbjct: 921 PRKTRTPSSHQSPQSAP-PSSPCTPSSSTAPPLPTNPKSPSEAPSLNNPNPRSSCTTPPS 979 Score = 27.5 bits (58), Expect = 4.0 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -1 Query: 100 SSAESPKLP-NPESWCPNPESWCPNPESWCPXP 5 SS+ +P LP NP+S P PNP S C P Sbjct: 945 SSSTAPPLPTNPKSPSEAPSLNNPNPRSSCTTP 977 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 27.9 bits (59), Expect = 3.1 Identities = 21/99 (21%), Positives = 38/99 (38%), Gaps = 3/99 (3%) Frame = -1 Query: 292 LTCLDQCLRPFAIFEVRAPPMAVPIPPNEVAMPSRPFSILSSSIPWSAKLEISFTCPALS 113 LT L P+A +++ P+P N +P+ + + ++ P + P Sbjct: 598 LTSSPHALLPYAT-RLKSSTNRYPLPTNRYPLPTNRYPLPTNRYPLPTN---RYPIPTNR 653 Query: 112 LPKLSSAESP---KLPNPESWCPNPESWCPNPESWCPXP 5 P + P ++P P P+P P+P P P Sbjct: 654 YPLPKNRYPPPYKQVPPPYKQVPHPYKQVPHPYKQVPAP 692 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 27.9 bits (59), Expect = 3.1 Identities = 26/84 (30%), Positives = 31/84 (36%), Gaps = 6/84 (7%) Frame = -1 Query: 238 PPMAVPIPP--NEVAMPSRPFSILSSSIPWSAKLEI---SFTCPALSLPKLSSAESPKLP 74 PP AVPIPP PS P P S + P + P + P+ P Sbjct: 1050 PPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQP 1109 Query: 73 NPESWCPNPESWCPN-PESWCPXP 5 P P P SW + PE P P Sbjct: 1110 KPTP-APRPRSWVESQPELHRPPP 1132 >SB_23827| Best HMM Match : DUF809 (HMM E-Value=9.1) Length = 159 Score = 27.5 bits (58), Expect = 4.0 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -2 Query: 177 FYLRLYHGLLNWKYPL-RVRHCLCQNCRARSHQSYRIRSRGVQIRSHGVQIRNHGVQXR 4 +Y+ YH + + L V +C+ A +H+ I+ GVQ G Q + G Q + Sbjct: 69 YYVTPYH--VTYSVTLYHVTYCVTPYATAATHKKKEIKQDGVQAEQDGGQAKQDGGQEK 125 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 27.5 bits (58), Expect = 4.0 Identities = 21/81 (25%), Positives = 29/81 (35%) Frame = -1 Query: 247 VRAPPMAVPIPPNEVAMPSRPFSILSSSIPWSAKLEISFTCPALSLPKLSSAESPKLPNP 68 V PP P PPNE + R S + + + P + + S P P P Sbjct: 371 VTPPPPPQPPPPNEQQVVDRTVE-YSEQVIYDLRGRTIRPFPTPNRRRRRSLVQPPPPPP 429 Query: 67 ESWCPNPESWCPNPESWCPXP 5 + P P P P + P P Sbjct: 430 PAPLPPPPPPPPQPTTALPDP 450 >SB_56086| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 520 Score = 27.5 bits (58), Expect = 4.0 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +2 Query: 200 CHFIGRYRHCHW--WCPHL 250 C+F G Y+H HW CP + Sbjct: 88 CYFFGYYKHPHWQSMCPEI 106 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 23.0 bits (47), Expect(2) = 7.0 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -1 Query: 85 PKLPNPESWCPNPESWCPNPESWCPXP 5 P+LP P P P S P P P P Sbjct: 1345 PRLPLPPLRLPPPHSRLPLPPPKLPPP 1371 Score = 21.8 bits (44), Expect(2) = 7.0 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -1 Query: 238 PPMAVPIPPNEVAMP 194 PP +P+PP+ + +P Sbjct: 1329 PPWELPLPPSGLPLP 1343 >SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17) Length = 815 Score = 26.6 bits (56), Expect = 7.1 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 173 IFVYTMVC*TGNILYVSGIV-FAKTVERGVTKAT 75 IF T+VC G I ++GIV FAK+ K+T Sbjct: 51 IFTITIVCGIGVIFLITGIVLFAKSTRTVPQKST 84 >SB_34419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 114 LCQNCRARSHQSYRIRSRGVQIRSHGVQIRNHGV 13 L QNC + SH+ + S +++R + NH V Sbjct: 592 LAQNCNSHSHEDVEVISNLIRMRLKTKPLANHYV 625 >SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) Length = 230 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = -1 Query: 181 SILSSSIPWSAKLEISFTCPALSLPKLSSAESPKLPNPESWCPNPESWCPNPESWC 14 ++ +S+P S L + L+ + + P P P+ P+P+ C N +S C Sbjct: 84 ALAMASLPRSVMLVLFLALWTLAQGQTTPVTCPTFPPPDECRPDPDDECKN-DSQC 138 >SB_56167| Best HMM Match : Plasmodium_HRP (HMM E-Value=6.8) Length = 285 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 225 CRYRPMKWQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRAR 91 C R + WQC+Q Y+ + + +Y L+V L Q +R Sbjct: 60 CAARRLSWQCIQNTTYKYMAHLYSAEHPEYNLQVHGTLIQRRASR 104 >SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1054 Score = 26.6 bits (56), Expect = 7.1 Identities = 9/27 (33%), Positives = 11/27 (40%) Frame = -1 Query: 85 PKLPNPESWCPNPESWCPNPESWCPXP 5 P+ P E W P W +SW P Sbjct: 1014 PRKPGAEIWMQTPSIWARRGDSWRDSP 1040 >SB_59425| Best HMM Match : Adeno_VII (HMM E-Value=4.5) Length = 250 Score = 26.2 bits (55), Expect = 9.3 Identities = 10/33 (30%), Positives = 23/33 (69%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 ++R+H S + R+ ++ R+HG++ HG++ R+ Sbjct: 2 KSRAH-SIKSRAHRIKSRAHGIKSCAHGIKYRA 33 Score = 26.2 bits (55), Expect = 9.3 Identities = 10/33 (30%), Positives = 23/33 (69%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 ++R+H S + R+ ++ R+HG++ HG++ R+ Sbjct: 72 KSRAH-SIKSRAHRIKSRAHGIKSCAHGIKYRA 103 Score = 26.2 bits (55), Expect = 9.3 Identities = 10/33 (30%), Positives = 23/33 (69%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 ++R+H S + R+ ++ R+HG++ HG++ R+ Sbjct: 142 KSRAH-SIKSRAHRIKSRAHGIKSCAHGIKYRA 173 Score = 26.2 bits (55), Expect = 9.3 Identities = 10/33 (30%), Positives = 23/33 (69%) Frame = -2 Query: 99 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 ++R+H S + R+ ++ R+HG++ HG++ R+ Sbjct: 212 KSRAH-SIKSRAHRIKSRAHGIKSCAHGIKYRA 243 >SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 969 Score = 26.2 bits (55), Expect = 9.3 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = -2 Query: 204 WQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRARSHQSYRIRSRGVQI 49 W +GP G + W + R CLC+NC YR + R V + Sbjct: 743 WGDKEGPHDMLKEWAQGNIRW-FESDYR-CLCENCDPSVSHRYRKQGRPVPV 792 >SB_56071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 856 Score = 26.2 bits (55), Expect = 9.3 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +1 Query: 211 WAVSALPLVVPSPQISQM 264 W + AL L+VP+P+++ M Sbjct: 396 WTIQALRLLVPAPEVNNM 413 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 26.2 bits (55), Expect = 9.3 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 138 YPLRVRHCLCQNCRARSHQSYRIRSRGVQIRSH 40 +P R+ HC C + +YR+++ G RSH Sbjct: 736 HPKRIYHCNIDGCGKQFSTAYRLKAHG---RSH 765 >SB_54349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 971 Score = 26.2 bits (55), Expect = 9.3 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 111 CQNCRARSHQSYRIRSRGVQIRSHGVQIRNHGVQXRS 1 C NC H + +GV+++ H V+ R G RS Sbjct: 221 CNNCGVVGHFAKSKFCKGVELKYHAVRGRGRGRARRS 257 >SB_30752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 26.2 bits (55), Expect = 9.3 Identities = 20/69 (28%), Positives = 30/69 (43%) Frame = -2 Query: 216 RPMKWQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRARSHQSYRIRSRGVQIRSHG 37 R ++CL G ++Y + HG + P R C+ C S +R R+R V G Sbjct: 491 RTTDYKCLHGRVKYYCKDCHG--SQICPHNRRKTRCRECNGGSICEHR-RARYVCKDCKG 547 Query: 36 VQIRNHGVQ 10 + HG Q Sbjct: 548 KGMCGHGKQ 556 >SB_1818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.2 bits (55), Expect = 9.3 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = -1 Query: 304 KQIVLTCLDQCLRPFAIFEVRAPPMAVPIPPNEVAMPSRPFSILSSSIPWSAKLEISFTC 125 +Q + T + A+F VR+ VPIPP V + ++ +SI +S + +S Sbjct: 20 RQAIKTAEGESTVTVALFWVRS---LVPIPPRRVWLIYAYVLLMLTSIRFSRDVSVSGDV 76 Query: 124 PALSLPKL--SSAESPKLPNPESW 59 + PK+ + ES K+ SW Sbjct: 77 LTVVKPKIIVVAYESLKIKENLSW 100 >SB_52546| Best HMM Match : ResIII (HMM E-Value=0.21) Length = 293 Score = 26.2 bits (55), Expect = 9.3 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = -2 Query: 204 WQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRARSHQSYRIRSRGVQI 49 W +GP G + W + R CLC+NC YR + R V + Sbjct: 203 WGDKEGPHDMLKEWAQGNIRW-FESDYR-CLCENCDPSVSHRYRKQGRPVPV 252 >SB_26236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 26.2 bits (55), Expect = 9.3 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +1 Query: 166 TKIKSKRALKALPLHWAVSALPLVVP 243 TK++S+ ++++LP H A S L++P Sbjct: 573 TKVQSEASMRSLPTHIAESLTALMLP 598 >SB_25066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1167 Score = 26.2 bits (55), Expect = 9.3 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -1 Query: 124 PALSLPKLSSAESPKLPNPESWCPNPESWCPNPESWCP 11 P+ SL +SS E K NP P+P P E+ CP Sbjct: 232 PSPSLSAVSSFERQKT-NPPHTAPSPPQADPAKEATCP 268 >SB_21268| Best HMM Match : DnaJ_CXXCXGXG (HMM E-Value=3.7) Length = 185 Score = 26.2 bits (55), Expect = 9.3 Identities = 20/69 (28%), Positives = 30/69 (43%) Frame = -2 Query: 216 RPMKWQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRARSHQSYRIRSRGVQIRSHG 37 R ++CL G ++Y + HG + P R C+ C S +R R+R V G Sbjct: 16 RTTDYKCLHGRVKYYCKDCHG--SQICPHNRRKTRCRECNGGSICEHR-RARYVCKDCKG 72 Query: 36 VQIRNHGVQ 10 + HG Q Sbjct: 73 KGMCEHGKQ 81 >SB_9042| Best HMM Match : TNFR_c6 (HMM E-Value=7.8) Length = 125 Score = 26.2 bits (55), Expect = 9.3 Identities = 20/69 (28%), Positives = 30/69 (43%) Frame = -2 Query: 216 RPMKWQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRARSHQSYRIRSRGVQIRSHG 37 R ++CL G ++Y + HG + P R C+ C S +R R+R V G Sbjct: 22 RTTDYKCLHGRVKYYCKDCHG--SQICPHNRRKTRCRECNGGSICEHR-RARYVCKDCKG 78 Query: 36 VQIRNHGVQ 10 + HG Q Sbjct: 79 KGMCGHGKQ 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,423,138 Number of Sequences: 59808 Number of extensions: 240641 Number of successful extensions: 1070 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1032 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 669365910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -