BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30546 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 56 2e-08 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 52 2e-07 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 52 2e-07 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 52 2e-07 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 52 2e-07 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 52 2e-07 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 52 2e-07 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 52 2e-07 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 52 3e-07 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 51 4e-07 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 51 4e-07 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 51 5e-07 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 51 5e-07 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 50 9e-07 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 50 1e-06 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 50 1e-06 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 50 1e-06 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 49 2e-06 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 49 2e-06 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 49 2e-06 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 49 2e-06 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 49 2e-06 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 49 2e-06 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 48 3e-06 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 48 3e-06 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 48 3e-06 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 48 5e-06 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 48 5e-06 At5g41690.1 68418.m05067 polyadenylate-binding protein, putative... 47 7e-06 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 47 7e-06 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 47 9e-06 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 46 1e-05 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 46 2e-05 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 46 2e-05 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 46 2e-05 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 46 2e-05 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 46 2e-05 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 45 3e-05 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 45 3e-05 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 45 3e-05 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 45 3e-05 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 45 3e-05 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 45 3e-05 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 45 3e-05 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 44 5e-05 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 44 5e-05 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 44 5e-05 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 44 6e-05 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 44 6e-05 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 44 6e-05 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 44 6e-05 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 44 6e-05 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 44 8e-05 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 44 8e-05 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 44 8e-05 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 44 8e-05 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 44 8e-05 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 43 1e-04 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 43 1e-04 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 43 1e-04 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 42 2e-04 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 42 2e-04 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 42 2e-04 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 42 2e-04 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 42 2e-04 At4g10610.1 68417.m01735 RNA-binding protein, putative 42 2e-04 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 42 2e-04 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 42 2e-04 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 42 3e-04 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 42 3e-04 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 42 3e-04 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 42 3e-04 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 42 3e-04 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 42 3e-04 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 42 3e-04 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 41 4e-04 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 41 4e-04 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 41 4e-04 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 41 4e-04 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 41 6e-04 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 41 6e-04 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 41 6e-04 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 40 8e-04 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 40 0.001 At4g25500.2 68417.m03674 arginine/serine-rich splicing factor RS... 40 0.001 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 39 0.002 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 39 0.002 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 38 0.003 At1g71800.1 68414.m08298 cleavage stimulation factor, putative s... 38 0.003 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 38 0.004 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 38 0.004 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 38 0.004 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 38 0.004 At1g45100.1 68414.m05170 polyadenylate-binding protein, putative... 38 0.005 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 38 0.005 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 37 0.007 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 37 0.007 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 37 0.007 At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing ... 37 0.009 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 37 0.009 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 37 0.009 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 37 0.009 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 36 0.012 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 36 0.016 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 36 0.016 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 36 0.016 At5g51300.2 68418.m06360 splicing factor-related contains simila... 36 0.016 At5g51300.1 68418.m06359 splicing factor-related contains simila... 36 0.016 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 36 0.016 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 36 0.016 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 36 0.021 At2g47310.1 68415.m05906 flowering time control protein-related ... 36 0.021 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 36 0.021 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 35 0.028 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 35 0.028 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 35 0.028 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 35 0.028 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 35 0.037 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 35 0.037 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 35 0.037 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 35 0.037 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 34 0.049 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 34 0.049 At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing ... 34 0.065 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 34 0.065 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 34 0.065 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 34 0.065 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 34 0.065 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 34 0.065 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 33 0.086 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 33 0.086 At3g10845.1 68416.m01306 RNA recognition motif (RRM)-containing ... 33 0.086 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 33 0.086 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 33 0.086 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 33 0.11 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 33 0.11 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 32 0.20 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 32 0.26 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 31 0.35 At1g43190.1 68414.m04977 polypyrimidine tract-binding protein, p... 31 0.46 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 31 0.61 At5g65260.1 68418.m08209 polyadenylate-binding protein family pr... 30 0.80 At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ... 30 0.80 At5g49000.1 68418.m06062 kelch repeat-containing F-box family pr... 30 1.1 At3g48830.1 68416.m05333 polynucleotide adenylyltransferase fami... 30 1.1 At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing ... 30 1.1 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 29 1.4 At1g09230.1 68414.m01030 RNA recognition motif (RRM)-containing ... 29 1.4 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 29 1.9 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 29 1.9 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 29 2.5 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 29 2.5 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 29 2.5 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 29 2.5 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 29 2.5 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 29 2.5 At4g39550.1 68417.m05592 kelch repeat-containing F-box family pr... 28 3.2 At4g22200.1 68417.m03209 potassium channel protein 2 (AKT2) (AKT... 28 3.2 At5g25790.1 68418.m03061 tesmin/TSO1-like CXC domain-containing ... 28 4.3 At2g30260.1 68415.m03684 small nuclear ribonucleoprotein U2B, pu... 28 4.3 At1g67140.1 68414.m07638 expressed protein 28 4.3 At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing ... 28 4.3 At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing ... 28 4.3 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 28 4.3 At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ... 27 5.7 At5g14690.1 68418.m01721 expressed protein predicted protein, Ar... 27 5.7 At1g59740.1 68414.m06726 proton-dependent oligopeptide transport... 27 5.7 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 27 7.5 At4g08450.1 68417.m01393 disease resistance protein (TIR-NBS-LRR... 27 7.5 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 27 7.5 At1g55290.1 68414.m06316 oxidoreductase, 2OG-Fe(II) oxygenase fa... 27 7.5 At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ... 27 9.9 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 27 9.9 At1g73660.1 68414.m08530 protein kinase family protein contains ... 27 9.9 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 27 9.9 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 27 9.9 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 55.6 bits (128), Expect = 2e-08 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 10/110 (9%) Frame = +1 Query: 214 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREAI 372 G +F+ NL + T A L+ +F+K+G +V C + R YGFV E E AI Sbjct: 110 GVGNVFVKNLPESVTNAVLQDMFKKFGNIVSCKVATLEDGKSRGYGFVQFEQEDAAHAAI 169 Query: 373 QNLNGELVHGQAI---KIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRE 513 Q LN +V + I K R P T +++ NL +RE Sbjct: 170 QTLNSTIVADKEIYVGKFMKKTDRVKPEEKYTNLYMKNLDADVSEDLLRE 219 Score = 37.1 bits (82), Expect = 0.007 Identities = 17/78 (21%), Positives = 41/78 (52%), Gaps = 7/78 (8%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREAIQNLN 384 I++ N++ TE +LR F + GT+ ++ + +GFV + +A++ + Sbjct: 306 IYVKNVNVAVTEEELRKHFSQCGTITSTKLMCDEKGKSKGFGFVCFSTPEEAIDAVKTFH 365 Query: 385 GELVHGQAIKIEAAKSRK 438 G++ HG+ + + A+ ++ Sbjct: 366 GQMFHGKPLYVAIAQKKE 383 Score = 32.3 bits (70), Expect = 0.20 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 7/77 (9%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREAIQNLN 384 +++ NL +E LR F ++G +V I R Y FV+ +N + R A + +N Sbjct: 203 LYMKNLDADVSEDLLREKFAEFGKIVSLAIAKDENRLCRGYAFVNFDNPEDARRAAETVN 262 Query: 385 GELVHGQAIKIEAAKSR 435 G + + + A+ + Sbjct: 263 GTKFGSKCLYVGRAQKK 279 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 52.4 bits (120), Expect = 2e-07 Identities = 28/77 (36%), Positives = 42/77 (54%) Frame = +1 Query: 214 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNGEL 393 G ++++G LS +T DL LF +YG V + D+ R+Y FV + + +A L+G Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADDARYYLDGRD 68 Query: 394 VHGQAIKIEAAKSRKAP 444 G I +EA SR AP Sbjct: 69 FDGSRITVEA--SRGAP 83 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 52.4 bits (120), Expect = 2e-07 Identities = 28/89 (31%), Positives = 49/89 (55%), Gaps = 8/89 (8%) Frame = +1 Query: 193 ESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMEN 348 +S+ P T K+FI LS T+E LR FE +G +VE I+ + Y F+ Sbjct: 273 DSESPPVKTKKLFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLEYTT 332 Query: 349 EQVGREAIQNLNGELVHGQAIKIEAAKSR 435 E+ A++ +NG++++G I ++ AK++ Sbjct: 333 EEAAGTALKEMNGKIINGWMIVVDVAKTK 361 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 52.0 bits (119), Expect = 2e-07 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 8/80 (10%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 ++ F+G L+ T + DL+ F ++G V++ I+ R +GFV ++E+ R+AI+ Sbjct: 6 YRCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIE 65 Query: 376 NLNGELVHGQAIKIEAAKSR 435 +NG+ + G+ I + A+SR Sbjct: 66 EMNGKELDGRVITVNEAQSR 85 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 52.0 bits (119), Expect = 2e-07 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 8/80 (10%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 ++ F+G L+ T + DL+ F ++G V++ I+ R +GFV ++E+ R+AI+ Sbjct: 6 YRCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIE 65 Query: 376 NLNGELVHGQAIKIEAAKSR 435 +NG+ + G+ I + A+SR Sbjct: 66 EMNGKELDGRVITVNEAQSR 85 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 52.0 bits (119), Expect = 2e-07 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 8/80 (10%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 ++ F+G L+ T + DL+ F ++G V++ I+ R +GFV ++E+ R+AI+ Sbjct: 6 YRCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIE 65 Query: 376 NLNGELVHGQAIKIEAAKSR 435 +NG+ + G+ I + A+SR Sbjct: 66 EMNGKELDGRVITVNEAQSR 85 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 52.0 bits (119), Expect = 2e-07 Identities = 28/92 (30%), Positives = 49/92 (53%), Gaps = 6/92 (6%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVR----NYGFVHMENEQVGREAIQNLNGEL 393 ++ GN+ + TE L+ +F G + C ++R +YGFVH + + AI LNG Sbjct: 65 VYAGNIHTQVTEILLQEIFASTGPIESCKLIRKDKSSYGFVHYFDRRCASMAIMTLNGRH 124 Query: 394 VHGQAIKIE--AAKSRKAPSTPTTKIFVGNLT 483 + GQ +K+ A ++ ++ IFVG+L+ Sbjct: 125 IFGQPMKVNWAYATGQREDTSSHFNIFVGDLS 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 12/77 (15%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVV----ECDIV--------RNYGFVHMENEQVGR 363 F IF+G+LS + T+A L F + + + ++ R +GFV N+Q + Sbjct: 148 FNIFVGDLSPEVTDAALFDSFSAFNSCSSYYRDARVMWDQKTGRSRGFGFVSFRNQQDAQ 207 Query: 364 EAIQNLNGELVHGQAIK 414 AI +NG+ V + I+ Sbjct: 208 TAINEMNGKWVSSRQIR 224 Score = 30.7 bits (66), Expect = 0.61 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKY--GTVVECDIVRN--YGFVHMENEQVGREAIQNLNGE 390 +++GNLS + T+ DL LF G + E + R+ +GFV AIQ N + Sbjct: 275 VYVGNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRDKGFGFVRYNTHDEAALAIQMGNAQ 333 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 52.0 bits (119), Expect = 2e-07 Identities = 28/92 (30%), Positives = 49/92 (53%), Gaps = 6/92 (6%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVR----NYGFVHMENEQVGREAIQNLNGEL 393 ++ GN+ + TE L+ +F G + C ++R +YGFVH + + AI LNG Sbjct: 65 VYAGNIHTQVTEILLQEIFASTGPIESCKLIRKDKSSYGFVHYFDRRCASMAIMTLNGRH 124 Query: 394 VHGQAIKIE--AAKSRKAPSTPTTKIFVGNLT 483 + GQ +K+ A ++ ++ IFVG+L+ Sbjct: 125 IFGQPMKVNWAYATGQREDTSSHFNIFVGDLS 156 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 8/73 (10%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 F IF+G+LS + T+A L F + + + ++ R +GFV N+Q + AI Sbjct: 148 FNIFVGDLSPEVTDAALFDSFSAFNSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAIN 207 Query: 376 NLNGELVHGQAIK 414 +NG+ V + I+ Sbjct: 208 EMNGKWVSSRQIR 220 Score = 30.7 bits (66), Expect = 0.61 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKY--GTVVECDIVRN--YGFVHMENEQVGREAIQNLNGE 390 +++GNLS + T+ DL LF G + E + R+ +GFV AIQ N + Sbjct: 271 VYVGNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRDKGFGFVRYNTHDEAALAIQMGNAQ 329 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 51.6 bits (118), Expect = 3e-07 Identities = 25/79 (31%), Positives = 47/79 (59%), Gaps = 8/79 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+++ LS +TTE LR FE++G ++ ++V + + F+ E E+ +AIQ Sbjct: 78 KLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETEEEAMKAIQG 137 Query: 379 LNGELVHGQAIKIEAAKSR 435 ++G+ + G+ I +E AK+R Sbjct: 138 MHGKFLDGRVIFVEEAKTR 156 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 51.2 bits (117), Expect = 4e-07 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 8/80 (10%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 F+I++GNL L LF ++G VV+ +V R +GFV M NE AI Sbjct: 207 FRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIA 266 Query: 376 NLNGELVHGQAIKIEAAKSR 435 L+G+ + G+AIK+ A+ R Sbjct: 267 ALDGQNLEGRAIKVNVAEER 286 Score = 39.1 bits (87), Expect = 0.002 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 15/101 (14%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+F+GNL L LFE+ GTV +++ R +GFV M + +A++ Sbjct: 114 KLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEK 173 Query: 379 LNGELVHGQAIKIEAAKSR-----KAPST--PTTKIFVGNL 480 N V+G+ + + A R + P +I+VGNL Sbjct: 174 FNSFEVNGRRLTVNRAAPRGSRPERQPRVYDAAFRIYVGNL 214 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 51.2 bits (117), Expect = 4e-07 Identities = 30/92 (32%), Positives = 51/92 (55%), Gaps = 6/92 (6%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVR----NYGFVHMENEQVGREAIQNLNGEL 393 +++GN+ + TE L+ +F G V C ++R +YGFVH + + AI +LNG Sbjct: 56 VYVGNIHIQVTEPLLQEVFAGTGPVESCKLIRKEKSSYGFVHYFDRRSAGLAILSLNGRH 115 Query: 394 VHGQAIKIE--AAKSRKAPSTPTTKIFVGNLT 483 + GQ IK+ A ++ ++ IFVG+L+ Sbjct: 116 LFGQPIKVNWAYASGQREDTSSHFNIFVGDLS 147 Score = 37.9 bits (84), Expect = 0.004 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 8/73 (10%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 F IF+G+LS + T+A L F Y T + ++ R +GFV N+Q + AI Sbjct: 139 FNIFVGDLSPEVTDAMLFTCFSVYPTCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAID 198 Query: 376 NLNGELVHGQAIK 414 + G+ + + I+ Sbjct: 199 EITGKWLGSRQIR 211 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 50.8 bits (116), Expect = 5e-07 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 8/79 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+FIG ++ E LR F KYG VV+ ++ R +GFV + + AIQ Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQA 100 Query: 379 LNGELVHGQAIKIEAAKSR 435 L+G +HG+ +K+ A R Sbjct: 101 LDGRDLHGRVVKVNYANDR 119 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 50.8 bits (116), Expect = 5e-07 Identities = 36/105 (34%), Positives = 53/105 (50%), Gaps = 12/105 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNGEL--VH 399 +F+GN +T ++DL LF+KYG V D+ Y FV+ E+E+ +AI+ L+ Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRVDMKSGYAFVYFEDERDAEDAIRKLDNFPFGYE 63 Query: 400 GQAIKIEAAKSR--------KAPST--PTTKIFVGNLTDKTRAPE 504 + + +E AK KAPS PT +FV N D R E Sbjct: 64 KRRLSVEWAKGERGRPRGDAKAPSNLKPTKTLFVINF-DPIRTKE 107 Score = 37.5 bits (83), Expect = 0.005 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = +1 Query: 217 TFKIFIGNLSD-KTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNGEL 393 T +F+ N +T E D+ FE YG V I RN+ FV E ++ +A++ Sbjct: 92 TKTLFVINFDPIRTKEHDIEKHFEPYGKVTNVRIRRNFSFVQFETQEDATKALEATQRSK 151 Query: 394 VHGQAIKIEAA 426 + + + +E A Sbjct: 152 ILDRVVSVEYA 162 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 50.0 bits (114), Expect = 9e-07 Identities = 25/73 (34%), Positives = 45/73 (61%), Gaps = 3/73 (4%) Frame = +1 Query: 241 LSDKTTEADLRPLFEKYGTVV---ECDIVRNYGFVHMENEQVGREAIQNLNGELVHGQAI 411 LS TT+ LR LF + ++ + + +GF+ E+E ++A++ LNG++V+G+ I Sbjct: 78 LSAYTTDQSLRQLFAPFARLIKDQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLI 137 Query: 412 KIEAAKSRKAPST 450 +E AK +AP+T Sbjct: 138 FVETAKEVEAPTT 150 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 49.6 bits (113), Expect = 1e-06 Identities = 34/113 (30%), Positives = 60/113 (53%), Gaps = 16/113 (14%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDI-----VRNYG--FVHMENEQVGREAIQNL 381 ++ N+ +T D+R LFEKYG+V++ ++ RN G F+ M + + A+++L Sbjct: 95 RLIAQNVPWTSTPEDIRSLFEKYGSVIDIEMSMHKKERNRGLVFIEMASPEEAATALKSL 154 Query: 382 NGELVHGQAIKIEAAKSRK--------APS-TPTTKIFVGNLTDKTRAPEVRE 513 G+ +K++ AK++K PS PT +FV NL + RA ++E Sbjct: 155 ESCEYEGRRLKVDYAKTKKKKTYAPRETPSPVPTFNLFVANLAFEARAKHLKE 207 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 49.6 bits (113), Expect = 1e-06 Identities = 27/77 (35%), Positives = 41/77 (53%) Frame = +1 Query: 214 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNGEL 393 G ++++G LS +T DL LF +YG V + D+ R+Y FV + + +A L+G Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADDARHYLDGRD 68 Query: 394 VHGQAIKIEAAKSRKAP 444 G I +E SR AP Sbjct: 69 FDGSRITVEF--SRGAP 83 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 49.6 bits (113), Expect = 1e-06 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 14/115 (12%) Frame = +1 Query: 211 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREA 369 +G IFI NL L F +GT++ C + + YGFV E E+ + A Sbjct: 133 SGKGNIFIKNLDASIDNKALFETFSSFGTILSCKVAMDVTGRSKGYGFVQFEKEESAQAA 192 Query: 370 IQNLNGELVHGQAIKI-------EAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRE 513 I LNG L++ + + + E A+ P+ T ++V NL + E+R+ Sbjct: 193 IDKLNGMLMNDKQVFVGHFIRRQERARDENTPTPRFTNVYVKNLPKEIGEDELRK 247 Score = 38.3 bits (85), Expect = 0.003 Identities = 18/78 (23%), Positives = 39/78 (50%), Gaps = 7/78 (8%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREAIQNLN 384 +++ NL D + L+ +F +YG V ++ R +GFV N + A+ +N Sbjct: 334 LYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQGMSRGFGFVAYSNPEEALRALSEMN 393 Query: 385 GELVHGQAIKIEAAKSRK 438 G+++ + + I A+ ++ Sbjct: 394 GKMIGRKPLYIALAQRKE 411 Score = 33.5 bits (73), Expect = 0.086 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 7/61 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQVGREAIQNLN 384 +++ NL + E +LR F K+G + ++R+ +GFV+ E + A++ +N Sbjct: 231 VYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSGNSRCFGFVNFECTEAAASAVEKMN 290 Query: 385 G 387 G Sbjct: 291 G 291 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 49.2 bits (112), Expect = 2e-06 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 8/81 (9%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+FIG LS TTE L F K G VVE IV + +GFV + ++A+ Sbjct: 35 KLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALME 94 Query: 379 LNGELVHGQAIKIEAAKSRKA 441 NG+ ++G+ I ++ AK++++ Sbjct: 95 FNGQQLNGRTIFVDYAKAKQS 115 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 49.2 bits (112), Expect = 2e-06 Identities = 29/92 (31%), Positives = 50/92 (54%), Gaps = 6/92 (6%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVR----NYGFVHMENEQVGREAIQNLNGEL 393 +++GN+ + TE L+ +F G V ++R +YGFVH + + AI +LNG Sbjct: 61 VYVGNIHTQVTEPLLQEIFTSTGPVESSKLIRKDKSSYGFVHYFDRRSAALAILSLNGRH 120 Query: 394 VHGQAIKIE--AAKSRKAPSTPTTKIFVGNLT 483 + GQ IK+ A ++ ++ IFVG+L+ Sbjct: 121 LFGQPIKVNWAYATGQREDTSSHFNIFVGDLS 152 Score = 39.1 bits (87), Expect = 0.002 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 8/73 (10%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 F IF+G+LS + T+A L F + + + ++ R +GFV N+Q + AI Sbjct: 144 FNIFVGDLSPEVTDATLYQSFSVFSSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAIN 203 Query: 376 NLNGELVHGQAIK 414 +NG+ + + I+ Sbjct: 204 EMNGKWLSSRQIR 216 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 49.2 bits (112), Expect = 2e-06 Identities = 25/84 (29%), Positives = 48/84 (57%), Gaps = 8/84 (9%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGR 363 G ++ F+G L+ T + L F +YG V++ I+ R +GFV ++E+ + Sbjct: 4 GDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMK 63 Query: 364 EAIQNLNGELVHGQAIKIEAAKSR 435 +AI+ +NG+ + G++I + A+SR Sbjct: 64 DAIEGMNGQDLDGRSITVNEAQSR 87 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 49.2 bits (112), Expect = 2e-06 Identities = 25/84 (29%), Positives = 48/84 (57%), Gaps = 8/84 (9%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGR 363 G ++ F+G L+ T + L F +YG V++ I+ R +GFV ++E+ + Sbjct: 4 GDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMK 63 Query: 364 EAIQNLNGELVHGQAIKIEAAKSR 435 +AI+ +NG+ + G++I + A+SR Sbjct: 64 DAIEGMNGQDLDGRSITVNEAQSR 87 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 49.2 bits (112), Expect = 2e-06 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 9/100 (9%) Frame = +1 Query: 214 GTFKIFIGNLSDKTTEADLRPLFEKYGTVV-------ECDIVRNYGFVHMENEQVGREAI 372 G ++++GNL +E DLR +FE +G+V E + + +GFV + R A+ Sbjct: 283 GARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRDETGLCKGFGFVQFARLEDARNAL 342 Query: 373 QNLNGEL-VHGQAIKIEAAKSR-KAPSTPTTKIFVGNLTD 486 NLNG+L + G+AIK+ A + + P T+ G+L D Sbjct: 343 -NLNGQLEIAGRAIKVSAVTDQTEVPEAGQTQT-TGDLDD 380 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 48.8 bits (111), Expect = 2e-06 Identities = 30/118 (25%), Positives = 53/118 (44%), Gaps = 12/118 (10%) Frame = +1 Query: 193 ESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENE 351 +S +G +F+ NL L F GT+V C + R YGFV + E Sbjct: 125 DSSARRSGVGNLFVKNLDKSVDNKTLHEAFSGCGTIVSCKVATDHMGQSRGYGFVQFDTE 184 Query: 352 QVGREAIQNLNGELVHGQAIKI-----EAAKSRKAPSTPTTKIFVGNLTDKTRAPEVR 510 + AI+ LNG++++ + I + + + A T ++V NL++ T E++ Sbjct: 185 DSAKNAIEKLNGKVLNDKQIFVGPFLRKEERESAADKMKFTNVYVKNLSEATTDDELK 242 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 7/78 (8%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQVGREAIQNLN 384 +++ NL D T+ LR LF ++GT+ C ++R+ GFV + +N Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTITSCKVMRDPSGTSKGSGFVAFSAASEASRVLNEMN 389 Query: 385 GELVHGQAIKIEAAKSRK 438 G++V G+ + + A+ ++ Sbjct: 390 GKMVGGKPLYVALAQRKE 407 Score = 41.9 bits (94), Expect = 2e-04 Identities = 19/62 (30%), Positives = 38/62 (61%), Gaps = 7/62 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQVGREAIQNLN 384 +++ NLS+ TT+ +L+ F +YG++ ++R+ +GFV+ EN + A++ LN Sbjct: 227 VYVKNLSEATTDDELKTTFGQYGSISSAVVMRDGDGKSRCFGFVNFENPEDAARAVEALN 286 Query: 385 GE 390 G+ Sbjct: 287 GK 288 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 48.4 bits (110), Expect = 3e-06 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 8/79 (10%) Frame = +1 Query: 217 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAI 372 T+ + + N++ +TT DL PLF KYG VV+ I R+ + FV + + +A+ Sbjct: 15 TYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAV 74 Query: 373 QNLNGELVHGQAIKIEAAK 429 + L+G +V G+ I ++ AK Sbjct: 75 ERLDGRVVDGREITVQFAK 93 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 48.4 bits (110), Expect = 3e-06 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 8/79 (10%) Frame = +1 Query: 217 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAI 372 T+ + + N++ +TT DL PLF KYG VV+ I R+ + FV + + +A+ Sbjct: 15 TYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAV 74 Query: 373 QNLNGELVHGQAIKIEAAK 429 + L+G +V G+ I ++ AK Sbjct: 75 ERLDGRVVDGREITVQFAK 93 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 48.4 bits (110), Expect = 3e-06 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 8/80 (10%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 F++++GNL L LF ++G VVE +V R +GFV M + EAI Sbjct: 244 FRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAIS 303 Query: 376 NLNGELVHGQAIKIEAAKSR 435 L+G+ + G+AI++ A+ R Sbjct: 304 ALDGQNLEGRAIRVNVAEER 323 Score = 42.3 bits (95), Expect = 2e-04 Identities = 31/101 (30%), Positives = 48/101 (47%), Gaps = 15/101 (14%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVV--------ECDIVRNYGFVHMENEQVGREAIQN 378 K+F+GNL+ L LFE+ GTV E D R +GFV M + A++ Sbjct: 151 KLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEK 210 Query: 379 LNGELVHGQAIKIEAAKSR-----KAPST--PTTKIFVGNL 480 N ++G+ + + A R +AP P +++VGNL Sbjct: 211 FNRYDLNGRLLTVNKAAPRGSRPERAPRVYEPAFRVYVGNL 251 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 47.6 bits (108), Expect = 5e-06 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 8/78 (10%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 ++ FIG L+ T++ LR FEKYG +VE +V R +GF+ + ++ EAI Sbjct: 7 YRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIA 66 Query: 376 NLNGELVHGQAIKIEAAK 429 +NG + G+ I ++ A+ Sbjct: 67 AMNGMDLDGRTITVDKAQ 84 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 47.6 bits (108), Expect = 5e-06 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREAIQNLNGELVH 399 IF+G L TE DL F +G VV I + GFV N Q EAI NLNG ++ Sbjct: 329 IFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIG 388 Query: 400 GQAIKIEAAKS 432 +++ +S Sbjct: 389 KNTVRLSWGRS 399 Score = 29.1 bits (62), Expect = 1.9 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 9/81 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFE-KYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 IF+G+L+ ++A L F +Y +V +V + YGFV +E A+ Sbjct: 215 IFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDENERSRAMTE 274 Query: 379 LNGELVHGQAIKIEAAKSRKA 441 +NG + +++ A ++A Sbjct: 275 MNGAFCSSRQMRVGIATPKRA 295 >At5g41690.1 68418.m05067 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GI:7673355 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 620 Score = 47.2 bits (107), Expect = 7e-06 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 7/94 (7%) Frame = +1 Query: 193 ESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENE 351 + + P + +F+ NLS +T +D+ F G VV ++ N YGFV + Sbjct: 235 DERPPNSVEEVLFVANLSPQTKISDIFDFFNCVGEVVSIRLMVNHEGKHVGYGFVEFASA 294 Query: 352 QVGREAIQNLNGELVHGQAIKIEAAKSRKAPSTP 453 ++A++N NGE +H I I+ AK+ P P Sbjct: 295 DETKKALENKNGEYLHDHKIFIDVAKTAPYPPGP 328 Score = 35.5 bits (78), Expect = 0.021 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 7/83 (8%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY-------GFVHMENEQVGREAIQNLN 384 +F+ NL +T ++ F+K G VV ++ N GFV + EA+Q N Sbjct: 129 LFVANLPYETKIPNIIDFFKKVGEVVRVQLIVNLKGKLVGCGFVEFASVNEAEEALQKKN 188 Query: 385 GELVHGQAIKIEAAKSRKAPSTP 453 GE + I ++ A ++KA P Sbjct: 189 GECLDNNKIFLDVA-NKKATYLP 210 Score = 33.9 bits (74), Expect = 0.065 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 7/83 (8%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY-------GFVHMENEQVGREAIQNLN 384 +F+ NLS +T + + F+ VV ++ N+ GFV + ++A+Q +N Sbjct: 491 LFVANLSPRTKISHIIKFFKDVAEVVRVRLIVNHRGEHVGCGFVEFASVNEAQKALQKMN 550 Query: 385 GELVHGQAIKIEAAKSRKAPSTP 453 GE + + I ++ + P P Sbjct: 551 GENLRSREIFLDVVELAPYPLRP 573 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 47.2 bits (107), Expect = 7e-06 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 2/73 (2%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNG-ELVH- 399 +F GN E DL LF KYG V D+ + FV+ME+E+ +AI+ L+ E Sbjct: 4 VFCGNFEYDAREGDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALDRFEFGRK 63 Query: 400 GQAIKIEAAKSRK 438 G+ +++E KS + Sbjct: 64 GRRLRVEWTKSER 76 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +1 Query: 226 IFIGNL-SDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNGELVHG 402 +F+ N +D T DL FE YG +V I RN+ F+ E ++ A+ N + Sbjct: 99 LFVINFDADNTRTRDLEKHFEPYGKIVNVRIRRNFAFIQYEAQEDATRALDASNNSKLMD 158 Query: 403 QAIKIEAA 426 + I +E A Sbjct: 159 KVISVEYA 166 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 46.8 bits (106), Expect = 9e-06 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 8/79 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 KIF+G +S T E LR F KYG VV+ I+ R + FV + + A+Q Sbjct: 35 KIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQ- 93 Query: 379 LNGELVHGQAIKIEAAKSR 435 L+G+ +HG+ I++ A R Sbjct: 94 LDGQDLHGRRIRVNYATER 112 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 46.4 bits (105), Expect = 1e-05 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 14/115 (12%) Frame = +1 Query: 211 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVEC----DIV---RNYGFVHMENEQVGREA 369 +G +FI NL L F +GT++ C D+V + YGFV E E+ + A Sbjct: 129 SGKGNVFIKNLDASIDNKALYETFSSFGTILSCKVAMDVVGRSKGYGFVQFEKEETAQAA 188 Query: 370 IQNLNGELVHGQAIKI-------EAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRE 513 I LNG L++ + + + + A+S T ++V NL + E+++ Sbjct: 189 IDKLNGMLLNDKQVFVGHFVRRQDRARSESGAVPSFTNVYVKNLPKEITDDELKK 243 Score = 42.7 bits (96), Expect = 1e-04 Identities = 21/99 (21%), Positives = 47/99 (47%), Gaps = 7/99 (7%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQVGREAIQNLN 384 +++ NL D + L+ +F +YG V C ++ N +GFV N + A++ +N Sbjct: 330 LYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGFVAYSNPEEALLAMKEMN 389 Query: 385 GELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAP 501 G+++ + + + A+ ++ +F + T +P Sbjct: 390 GKMIGRKPLYVALAQRKEERQAHLQSLFTQIRSPGTMSP 428 Score = 33.1 bits (72), Expect = 0.11 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 7/61 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREAIQNLN 384 +++ NL + T+ +L+ F KYG + ++ R++GFV+ + + A++ +N Sbjct: 227 VYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSGNSRSFGFVNFVSPEAAAVAVEKMN 286 Query: 385 G 387 G Sbjct: 287 G 287 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/53 (39%), Positives = 31/53 (58%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLN 384 +F GN E+DL LF KYG V D+ + FV+ME+E+ +AI+ L+ Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALD 56 Score = 37.5 bits (83), Expect = 0.005 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +1 Query: 226 IFIGNLSDKTTEA-DLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNGELVHG 402 +F+ N + T DL FE YG +V I RN+ F+ E ++ A+ N + Sbjct: 98 LFVINFDAQNTRTRDLERHFEPYGKIVNVRIRRNFAFIQYEAQEDATRALDATNSSKLMD 157 Query: 403 QAIKIEAA 426 + I +E A Sbjct: 158 KVISVEYA 165 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/53 (39%), Positives = 31/53 (58%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLN 384 +F GN E+DL LF KYG V D+ + FV+ME+E+ +AI+ L+ Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALD 56 Score = 37.5 bits (83), Expect = 0.005 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +1 Query: 226 IFIGNLSDKTTEA-DLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNGELVHG 402 +F+ N + T DL FE YG +V I RN+ F+ E ++ A+ N + Sbjct: 98 LFVINFDAQNTRTRDLERHFEPYGKIVNVRIRRNFAFIQYEAQEDATRALDATNSSKLMD 157 Query: 403 QAIKIEAA 426 + I +E A Sbjct: 158 KVISVEYA 165 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDI--VRNYGFVHMENEQVGREAIQNLNGELVH 399 I + NL TE +L+ F + G V+ I + YG+V + EA+Q + G+++ Sbjct: 239 ISVANLDQNVTEEELKKAFSQLGEVIYVKIPATKGYGYVQFKTRPSAEEAVQRMQGQVIG 298 Query: 400 GQAIKIEAAKS 432 QA++I +K+ Sbjct: 299 QQAVRISWSKN 309 Score = 29.9 bits (64), Expect = 1.1 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 9/92 (9%) Frame = +1 Query: 190 SESKMPGTGTFKIFIGNLSDKTTEADLRPLFE-KYGTVVECDIV--------RNYGFVHM 342 S K+ IF+G+L+ T+ L+ F Y +V +V + YGFV Sbjct: 106 SGQKVDAGPDHSIFVGDLAPDVTDYLLQETFRVHYSSVRGAKVVTDPSTGRSKGYGFVKF 165 Query: 343 ENEQVGREAIQNLNGELVHGQAIKIEAAKSRK 438 E A+ +NG + ++I AA +K Sbjct: 166 AEESERNRAMAEMNGLYCSTRPMRISAATPKK 197 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/73 (31%), Positives = 43/73 (58%), Gaps = 8/73 (10%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYG--------FVHMENEQVGREAIQNL 381 +++G + TE DL +F +YG +V+ +++R+ G F+ E+++ A+ NL Sbjct: 38 VYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQRSTILAVDNL 97 Query: 382 NGELVHGQAIKIE 420 NG LV G+ IK++ Sbjct: 98 NGALVLGRTIKVD 110 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 45.6 bits (103), Expect = 2e-05 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 8/92 (8%) Frame = +1 Query: 193 ESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMEN 348 +SK G +F+G LS TTE LR + KYG + +VR+ YGFV E Sbjct: 55 DSKAVGDPYCTLFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYET 114 Query: 349 EQVGREAIQNLNGELVHGQAIKIEAAKSRKAP 444 E+ A ++ + L+ G+ I ++ + + P Sbjct: 115 EKEMLRAYEDAHHSLIDGREIIVDYNRQQLMP 146 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 45.2 bits (102), Expect = 3e-05 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 8/84 (9%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGR 363 G+G ++++GNLS + L LF + G VVE ++ + +GFV + + Q + Sbjct: 246 GSGN-RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQ 304 Query: 364 EAIQNLNGELVHGQAIKIEAAKSR 435 +AI +LNG + G+ I++ A++R Sbjct: 305 KAINSLNGADLDGRQIRVSEAEAR 328 Score = 39.9 bits (89), Expect = 0.001 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+F+GNLS A L LFE G V +++ R +GFV M A Q Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQ 159 Query: 379 LNGELVHGQAIKIEA 423 NG G+ +++ A Sbjct: 160 FNGYEFEGRPLRVNA 174 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 45.2 bits (102), Expect = 3e-05 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 8/84 (9%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGR 363 G+G ++++GNLS + L LF + G VVE ++ + +GFV + + Q + Sbjct: 254 GSGN-RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQ 312 Query: 364 EAIQNLNGELVHGQAIKIEAAKSR 435 +AI +LNG + G+ I++ A++R Sbjct: 313 KAINSLNGADLDGRQIRVSEAEAR 336 Score = 39.9 bits (89), Expect = 0.001 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+F+GNLS A L LFE G V +++ R +GFV M A Q Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQ 159 Query: 379 LNGELVHGQAIKIEA 423 NG G+ +++ A Sbjct: 160 FNGYEFEGRPLRVNA 174 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 45.2 bits (102), Expect = 3e-05 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREAIQNLNGELVH 399 IF+G L T+ DL+ F ++G +V I + GFV N EA++ LNG ++ Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLNGTVIG 367 Query: 400 GQAIKI 417 Q +++ Sbjct: 368 KQTVRL 373 Score = 36.7 bits (81), Expect = 0.009 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 10/92 (10%) Frame = +1 Query: 193 ESKMPGTGT-FKIFIGNLSDKTTEADLRPLF-EKYGTVVECDIV--------RNYGFVHM 342 E ++ G IF+G+L+ ++A L F EKY +V +V + YGFV Sbjct: 189 EKRLENNGPDLSIFVGDLAPDVSDALLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRF 248 Query: 343 ENEQVGREAIQNLNGELVHGQAIKIEAAKSRK 438 +E +A+ +NG +A++I A RK Sbjct: 249 GDENERTKAMTEMNGVKCSSRAMRIGPATPRK 280 Score = 28.7 bits (61), Expect = 2.5 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 17/102 (16%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFE--KYGTVVECDIVRN--------YGFVHMENEQVGREAIQ 375 I++G+L + EA L F + +V ++RN YGFV E+ V + +Q Sbjct: 105 IWVGDLQNWMDEAYLNSAFTSAEEREIVSLKVIRNKHNGSSEGYGFVEFESHDVADKVLQ 164 Query: 376 NLNGELVHG--QAIKIEAA-----KSRKAPSTPTTKIFVGNL 480 NG + Q ++ A + R + P IFVG+L Sbjct: 165 EFNGAPMPNTDQPFRLNWASFSTGEKRLENNGPDLSIFVGDL 206 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 45.2 bits (102), Expect = 3e-05 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREAIQNLNGELVH 399 IF+G L T+ DL+ F ++G +V I + GFV N EA++ LNG ++ Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLNGTVIG 365 Query: 400 GQAIKI 417 Q +++ Sbjct: 366 KQTVRL 371 Score = 35.5 bits (78), Expect = 0.021 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 10/92 (10%) Frame = +1 Query: 193 ESKMPGTGT-FKIFIGNLSDKTTEADLRPLF-EKYGTVVECDIV--------RNYGFVHM 342 E ++ G IF+G+LS ++ L F EKY +V +V + YGFV Sbjct: 187 EKRLENNGPDLSIFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRF 246 Query: 343 ENEQVGREAIQNLNGELVHGQAIKIEAAKSRK 438 +E +A+ +NG +A++I A RK Sbjct: 247 GDENERTKAMTEMNGVKCSSRAMRIGPATPRK 278 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 44.8 bits (101), Expect = 3e-05 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREAIQNLNGELVH 399 IF+G + TE DL+ +F ++G +V I + GFV N +A+ LNG + Sbjct: 280 IFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSVLNGTQLG 339 Query: 400 GQAIKIEAAKS 432 GQ+I++ +S Sbjct: 340 GQSIRLSWGRS 350 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 9/80 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEK-YGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 +F+G+L+ T+ L F+ Y +V +V + YGFV +E A+ Sbjct: 175 VFVGDLAPDVTDHMLTETFKAVYSSVKGAKVVNDRTTGRSKGYGFVRFADESEQIRAMTE 234 Query: 379 LNGELVHGQAIKIEAAKSRK 438 +NG+ + ++ A ++K Sbjct: 235 MNGQYCSSRPMRTGPAANKK 254 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 44.8 bits (101), Expect = 3e-05 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 8/79 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 +IF+G LS TE L F++YG + EC I+ R +GF+ + + +AI++ Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKH 72 Query: 379 LNGELVHGQAIKIEAAKSR 435 ++G + + I + A+ + Sbjct: 73 MHGRELGNKVISVNKAEPK 91 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 44.8 bits (101), Expect = 3e-05 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 8/79 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 +IF+G LS TE L F++YG + EC I+ R +GF+ + + +AI++ Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKH 72 Query: 379 LNGELVHGQAIKIEAAKSR 435 ++G + + I + A+ + Sbjct: 73 MHGRELGNKVISVNKAEPK 91 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 44.4 bits (100), Expect = 5e-05 Identities = 23/83 (27%), Positives = 44/83 (53%), Gaps = 7/83 (8%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQVGREAIQNLN 384 +++G L TE +R +F YG+V+ IV + YGFV N + +AI++++ Sbjct: 9 VYVGGLPYDITEEAVRRVFSIYGSVLTVKIVNDRSVRGKCYGFVTFSNRRSADDAIEDMD 68 Query: 385 GELVHGQAIKIEAAKSRKAPSTP 453 G+ + G+A+++ +R P Sbjct: 69 GKSIGGRAVRVNDVTTRGGRMNP 91 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 44.4 bits (100), Expect = 5e-05 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 7/99 (7%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREAIQNLN 384 +++ NLS+ E LR +F YG +V ++ + +GFV N + ++A + LN Sbjct: 306 LYVKNLSESMNETRLREIFGCYGQIVSAKVMCHENGRSKGFGFVCFSNCEESKQAKRYLN 365 Query: 385 GELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAP 501 G LV G+ I + A+ ++ + F T+AP Sbjct: 366 GFLVDGKPIVVRVAERKEDRIKRLQQYFQAQPRQYTQAP 404 Score = 43.6 bits (98), Expect = 8e-05 Identities = 25/103 (24%), Positives = 52/103 (50%), Gaps = 11/103 (10%) Frame = +1 Query: 211 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV------RNYGFVHMENEQVGREAI 372 TG +++ NL T + L +F +G+++ C +V + +GFV + EQ A Sbjct: 109 TGFANLYVKNLDSSITSSCLERMFCPFGSILSCKVVEENGQSKGFGFVQFDTEQSAVSAR 168 Query: 373 QNLNGELVHGQAIKI-----EAAKSRKAPSTPTTKIFVGNLTD 486 L+G +V+G+ + + + ++ A + +T ++V NL + Sbjct: 169 SALHGSMVYGKKLFVAKFINKDERAAMAGNQDSTNVYVKNLIE 211 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 44.4 bits (100), Expect = 5e-05 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 8/83 (9%) Frame = +1 Query: 217 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAI 372 T KIF+G + TE +L+ F KYG VVE ++R+ +GFV ++E+V E + Sbjct: 108 TKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELL 167 Query: 373 QNLNGELVHGQAIKIEAAKSRKA 441 N + ++I+ A+ +K+ Sbjct: 168 SKGNMIDMADTQVEIKKAEPKKS 190 Score = 40.3 bits (90), Expect = 8e-04 Identities = 30/113 (26%), Positives = 50/113 (44%), Gaps = 11/113 (9%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGR 363 G KIFIG L TT F KYG + + I+R+ +GF+ + V Sbjct: 15 GASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVD 74 Query: 364 EAIQN---LNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRE 513 + I++ +NG+ V + + A ++ T KIFVG + E+++ Sbjct: 75 KVIEDTHVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKD 127 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 44.0 bits (99), Expect = 6e-05 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 ++++GNL T ++L +F + GTVV+ IV R +GFV M + + +EA+Q Sbjct: 117 RLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQM 176 Query: 379 LNGELVHGQAIKI 417 N + G+ +K+ Sbjct: 177 FNSSQIGGRTVKV 189 Score = 38.3 bits (85), Expect = 0.003 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 8/92 (8%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K++ GNL T L+ F V+ ++ R +GF+ E+ + + A+ Sbjct: 220 KVYAGNLGWNLTSQGLKDAFGDQPGVLGAKVIYERNTGRSRGFGFISFESAENVQSALAT 279 Query: 379 LNGELVHGQAIKIEAAKSRKAPSTPTTKIFVG 474 +NG V G+A+++ A R+ P+ + G Sbjct: 280 MNGVEVEGRALRLNLASEREKPTVSPPSVEEG 311 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 44.0 bits (99), Expect = 6e-05 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 2/69 (2%) Frame = +1 Query: 232 IGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREAIQNLNGELVHGQ 405 + NLS T LR LF GTVV+C I ++ ++ N + A+ LN V G+ Sbjct: 355 VSNLSPSLTTEQLRQLFSFCGTVVDCSITDSKHIAYIEYSNSEEATAALA-LNNTEVFGR 413 Query: 406 AIKIEAAKS 432 A+ +E AKS Sbjct: 414 ALNVEIAKS 422 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 44.0 bits (99), Expect = 6e-05 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 5/88 (5%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDI-----VRNYGFVHMENEQVGREAIQNLNGE 390 +++GNL E ++ LF KYG VV+ D+ Y FV ++ + +AI +G Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGY 68 Query: 391 LVHGQAIKIEAAKSRKAPSTPTTKIFVG 474 G +++E A + S T F G Sbjct: 69 DFDGHRLRVELAHGGRRSSDDTRGSFNG 96 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 44.0 bits (99), Expect = 6e-05 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 5/88 (5%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDI-----VRNYGFVHMENEQVGREAIQNLNGE 390 +++GNL E ++ LF KYG VV+ D+ Y FV ++ + +AI +G Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGY 68 Query: 391 LVHGQAIKIEAAKSRKAPSTPTTKIFVG 474 G +++E A + S T F G Sbjct: 69 DFDGHRLRVELAHGGRRSSDDTRGSFNG 96 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 44.0 bits (99), Expect = 6e-05 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 5/88 (5%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDI-----VRNYGFVHMENEQVGREAIQNLNGE 390 +++GNL E ++ LF KYG VV+ D+ Y FV ++ + +AI +G Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGY 68 Query: 391 LVHGQAIKIEAAKSRKAPSTPTTKIFVG 474 G +++E A + S T F G Sbjct: 69 DFDGHRLRVELAHGGRRSSDDTRGSFNG 96 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 43.6 bits (98), Expect = 8e-05 Identities = 28/85 (32%), Positives = 41/85 (48%), Gaps = 8/85 (9%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQN 378 K++IG LS T E L+ F + V E ++ N YGFV+ +E AI Sbjct: 32 KLYIGGLSPGTDEHSLKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91 Query: 379 LNGELVHGQAIKIEAAKSRKAPSTP 453 +NG+ ++G I + AK PS P Sbjct: 92 MNGQELNGFNISVNVAKD--WPSLP 114 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 43.6 bits (98), Expect = 8e-05 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 8/72 (11%) Frame = +1 Query: 187 VSESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHM 342 +S++ T KIF+GNL+ +TT DLR FE++G VV+ ++V + YGF+ Sbjct: 1 MSQTNNHDTRVTKIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITF 60 Query: 343 ENEQVGREAIQN 378 + A+QN Sbjct: 61 RDYVSTVRALQN 72 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +1 Query: 448 TPTTKIFVGNLTDKTRAPEVR 510 T TKIFVGNLT +T A ++R Sbjct: 9 TRVTKIFVGNLTWRTTADDLR 29 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 43.6 bits (98), Expect = 8e-05 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 2/70 (2%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNL-NGELVHG 402 +++GN T +DL LF K+G V D+ Y FV+ E+E+ +AI+ N +G Sbjct: 4 VYVGNFDYDTRHSDLERLFSKFGRVKRVDMKSGYAFVYFEDERDAEDAIRRTDNTTFGYG 63 Query: 403 -QAIKIEAAK 429 + + +E AK Sbjct: 64 RRKLSVEWAK 73 Score = 35.1 bits (77), Expect = 0.028 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +1 Query: 217 TFKIFIGNLSD-KTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNGEL 393 T +F+ N +T E D+ FE YG V+ + RN+ FV ++ +A+ + + Sbjct: 94 TKTLFVINFDPIRTRERDMERHFEPYGKVLNVRMRRNFAFVQFATQEDATKALDSTHNSK 153 Query: 394 VHGQAIKIEAA 426 + + + +E A Sbjct: 154 LLDKVVSVEYA 164 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 43.6 bits (98), Expect = 8e-05 Identities = 25/84 (29%), Positives = 48/84 (57%), Gaps = 8/84 (9%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGR 363 G+G ++++GNLS + L LF + G VVE ++ + +GFV ++ Q + Sbjct: 201 GSGN-RVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQ 259 Query: 364 EAIQNLNGELVHGQAIKIEAAKSR 435 AI++L+G + G+ I++ A++R Sbjct: 260 NAIKSLDGADLDGRQIRVSEAEAR 283 Score = 38.7 bits (86), Expect = 0.002 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 8/75 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+F+GNL A L LFE G V +++ R +GFV M + A Q Sbjct: 92 KLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQ 151 Query: 379 LNGELVHGQAIKIEA 423 NG + G+ +++ A Sbjct: 152 FNGYELDGRPLRVNA 166 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 43.6 bits (98), Expect = 8e-05 Identities = 29/122 (23%), Positives = 55/122 (45%), Gaps = 12/122 (9%) Frame = +1 Query: 187 VSESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHME 345 V + + +G IFI NL L F +G ++ C + + YGFV + Sbjct: 122 VRDPSLRKSGVGNIFIKNLDKSIDHKALHETFSAFGPILSCKVAVDPSGQSKGYGFVQYD 181 Query: 346 NEQVGREAIQNLNGELVHGQAIKIE--AAKSRKAPS---TPTTKIFVGNLTDKTRAPEVR 510 ++ + AI LNG L++ + + + K ++ PS T ++V NL++ E+ Sbjct: 182 TDEAAQGAIDKLNGMLLNDKQVYVGPFVHKLQRDPSGEKVKFTNVYVKNLSESLSDEELN 241 Query: 511 EL 516 ++ Sbjct: 242 KV 243 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/94 (23%), Positives = 45/94 (47%), Gaps = 7/94 (7%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQVGREAIQNLN 384 +++ NLS+ ++ +L +F ++G C I+R+ +GFV+ EN A+ LN Sbjct: 226 VYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDGEGKSKGFGFVNFENSDDAARAVDALN 285 Query: 385 GELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTD 486 G+ + + A+ + T + F +L + Sbjct: 286 GKTFDDKEWFVGKAQKKSERETELKQKFEQSLKE 319 Score = 37.5 bits (83), Expect = 0.005 Identities = 18/78 (23%), Positives = 39/78 (50%), Gaps = 7/78 (8%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQVGREAIQNLN 384 +++ NL + T+ LR F +GT+ C ++R+ GFV + AI +N Sbjct: 329 LYVKNLDESVTDDKLREHFAPFGTITSCKVMRDPSGVSRGSGFVAFSTPEEATRAITEMN 388 Query: 385 GELVHGQAIKIEAAKSRK 438 G+++ + + + A+ ++ Sbjct: 389 GKMIVTKPLYVALAQRKE 406 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 43.2 bits (97), Expect = 1e-04 Identities = 32/108 (29%), Positives = 53/108 (49%), Gaps = 11/108 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 KIF+G L+ +TT A+ F KYG + + I+ R +GFV + V + IQ Sbjct: 43 KIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQ- 101 Query: 379 LNGELVHGQAIKIEAAKSRKAPST---PTTKIFVGNLTDKTRAPEVRE 513 + ++ G+ ++I+ R + S+ T KIFVG + E +E Sbjct: 102 -DNHIIIGKQVEIKRTIPRGSMSSNDFKTKKIFVGGIPSSVDDDEFKE 148 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 43.2 bits (97), Expect = 1e-04 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 8/93 (8%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVEC--------DIVRNYGFVHMENEQVGREAIQNL 381 +++G L + +E L LF + G VV ++ +NYGF+ +E+ AI+ L Sbjct: 27 VYVGGLDAQLSEELLWELFVQAGPVVNVYVPKDRVTNLHQNYGFIEYRSEEDADYAIKVL 86 Query: 382 NGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNL 480 N +HG+ I++ A K +F+GNL Sbjct: 87 NMIKLHGKPIRVNKASQDKKSLDVGANLFIGNL 119 Score = 27.9 bits (59), Expect = 4.3 Identities = 17/76 (22%), Positives = 33/76 (43%), Gaps = 9/76 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV---------RNYGFVHMENEQVGREAIQN 378 +FIGNL E L F +G + + R +GF+ ++ + AI++ Sbjct: 114 LFIGNLDPDVDEKLLYDTFSAFGVIASNPKIMRDPDTGNSRGFGFISYDSFEASDAAIES 173 Query: 379 LNGELVHGQAIKIEAA 426 + G+ + + I + A Sbjct: 174 MTGQYLSNRQITVSYA 189 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 42.7 bits (96), Expect = 1e-04 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 8/80 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+F+GNLS T L F + G VV +V R YGFV ++ A+++ Sbjct: 178 KLFVGNLSWTVTSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETALES 237 Query: 379 LNGELVHGQAIKIEAAKSRK 438 L+G + G+AI++ A+ +K Sbjct: 238 LDGFELEGRAIRVNLAQGKK 257 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 42.3 bits (95), Expect = 2e-04 Identities = 20/79 (25%), Positives = 42/79 (53%), Gaps = 8/79 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 +IF+G LS + T+ DL F ++G +++C I+ R +GF+ + + E+I+ Sbjct: 8 RIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIRE 67 Query: 379 LNGELVHGQAIKIEAAKSR 435 ++G + I + A+ + Sbjct: 68 MHGRDFGDRVISVNRAEPK 86 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 42.3 bits (95), Expect = 2e-04 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 8/64 (12%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 ++ F+G L+ T + DL+ F ++G V++ I+ R +GFV ++E+ R+AI+ Sbjct: 6 YRCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIE 65 Query: 376 NLNG 387 +NG Sbjct: 66 EMNG 69 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 42.3 bits (95), Expect = 2e-04 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 8/74 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQN 378 ++++GNLS TT+ LR F YG VV+ ++R+ +GFV + A+ Sbjct: 4 RVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSG 63 Query: 379 LNGELVHGQAIKIE 420 ++G+ ++G+ + ++ Sbjct: 64 MDGKELNGRRVSVK 77 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 42.3 bits (95), Expect = 2e-04 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 8/77 (10%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQNL 381 +F+ L+ T + DL +F ++GTVV D++R+ Y F+ EN++ +A + Sbjct: 245 LFVCKLNPVTEDEDLHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEFENKESCEQAYFKM 304 Query: 382 NGELVHGQAIKIEAAKS 432 + L+ + I ++ ++S Sbjct: 305 DNALIDDRRIHVDFSQS 321 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 42.3 bits (95), Expect = 2e-04 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 7/86 (8%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREAIQNLN 384 +++ NL + T+ADL+ LF ++G + ++ R +GFV+ E + AI+ +N Sbjct: 121 VYVKNLVETATDADLKRLFGEFGEITSAVVMKDGEGKSRRFGFVNFEKAEAAVTAIEKMN 180 Query: 385 GELVHGQAIKIEAAKSRKAPSTPTTK 462 G +V + + + A+ RK T K Sbjct: 181 GVVVDEKELHVGRAQ-RKTNRTEDLK 205 Score = 40.3 bits (90), Expect = 8e-04 Identities = 18/78 (23%), Positives = 38/78 (48%), Gaps = 7/78 (8%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREAIQNLN 384 +++ NL D L LF ++GT+ C ++ + GFV + +A+ +N Sbjct: 225 LYVKNLDDSVDNTKLEELFSEFGTITSCKVMVHSNGISKGVGFVEFSTSEEASKAMLKMN 284 Query: 385 GELVHGQAIKIEAAKSRK 438 G++V + I + A+ ++ Sbjct: 285 GKMVGNKPIYVSLAQCKE 302 >At4g10610.1 68417.m01735 RNA-binding protein, putative Length = 336 Score = 41.9 bits (94), Expect = 2e-04 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 6/83 (7%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDI------VRNYGFVHMENEQVGREAIQNLNG 387 +++ ++ + TE L LF +G VV+C I V + F+ +E VG NL+G Sbjct: 152 VYVSDIDQQVTEEQLAGLFIGFGQVVDCRICGDPNSVLRFAFIEFTDE-VGARTALNLSG 210 Query: 388 ELVHGQAIKIEAAKSRKAPSTPT 456 ++ +K+ +K+ AP PT Sbjct: 211 TMLGFYPVKVMPSKTAIAPVNPT 233 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 41.9 bits (94), Expect = 2e-04 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 8/64 (12%) Frame = +1 Query: 217 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAI 372 T KIF+G + TE +L+ F KYG VVE ++R+ +GFV ++E+V E + Sbjct: 108 TKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELL 167 Query: 373 QNLN 384 N Sbjct: 168 SKGN 171 Score = 40.3 bits (90), Expect = 8e-04 Identities = 30/113 (26%), Positives = 50/113 (44%), Gaps = 11/113 (9%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGR 363 G KIFIG L TT F KYG + + I+R+ +GF+ + V Sbjct: 15 GASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVD 74 Query: 364 EAIQN---LNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRE 513 + I++ +NG+ V + + A ++ T KIFVG + E+++ Sbjct: 75 KVIEDTHVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKD 127 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 41.9 bits (94), Expect = 2e-04 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREAIQNLNGELVH 399 +F+G L T+ L+ +F +YG +V I + GFV + EA++ LNG + Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLG 322 Query: 400 GQAIKIEAAKS 432 G +++ +S Sbjct: 323 GTTVRLSWGRS 333 Score = 28.7 bits (61), Expect = 2.5 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 9/92 (9%) Frame = +1 Query: 190 SESKMPGTGTFKIFIGNLSDKTTEADLRPLFE-KYGTVVECDIV--------RNYGFVHM 342 S K + + IF+G+L+ T+ L F Y +V +V + YGFV Sbjct: 145 SGDKRDDSPDYTIFVGDLAADVTDYILLETFRASYPSVKGAKVVIDRVTGRTKGYGFVRF 204 Query: 343 ENEQVGREAIQNLNGELVHGQAIKIEAAKSRK 438 +E A+ +NG + ++I A S+K Sbjct: 205 SDESEQIRAMTEMNGVPCSTRPMRIGPAASKK 236 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 41.5 bits (93), Expect = 3e-04 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREAIQNLNGELVH 399 IF+G L T+ +L+ +F ++G ++ I + GFV N+ A+ LNG + Sbjct: 262 IFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQLG 321 Query: 400 GQAIKIEAAKS 432 GQ+I++ +S Sbjct: 322 GQSIRLSWGRS 332 Score = 33.9 bits (74), Expect = 0.065 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 10/86 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEK-YGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 IF+G+L+ + T+ L F+ YG+V +V + YGFV +E A+ Sbjct: 156 IFVGDLAPEVTDYMLSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRFADENEQMRAMTE 215 Query: 379 LNGELVHGQAIKIEAAKSRKA-PSTP 453 +NG+ + ++I A ++ A P P Sbjct: 216 MNGQYCSTRPMRIGPAANKNALPMQP 241 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 41.5 bits (93), Expect = 3e-04 Identities = 22/94 (23%), Positives = 46/94 (48%), Gaps = 7/94 (7%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQVGREAIQNLN 384 +++ NL++ TT+ DL+ F +YG + ++++ +GFV+ EN A+++LN Sbjct: 31 VYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEGKSKGFGFVNFENADDAARAVESLN 90 Query: 385 GELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTD 486 G + + A+ + T + NL + Sbjct: 91 GHKFDDKEWYVGRAQKKSERETELRVRYEQNLKE 124 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 41.5 bits (93), Expect = 3e-04 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 12/114 (10%) Frame = +1 Query: 211 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYG--------FVHMENEQVGRE 366 + T K+F+G++ TE ++RP FE++G V+E ++++ FV + Sbjct: 117 SSTVKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADR 176 Query: 367 AIQNLNGEL-VHGQAIKIE---AAKSRKAPSTPTTKIFVGNLTDKTRAPEVREL 516 AI+ L+ ++ + G ++ A R+ T K+FVG+L + EV E+ Sbjct: 177 AIRALHNQITLPGGTGPVQVRYADGERERIGTLEFKLFVGSLNKQATEKEVEEI 230 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 7/72 (9%) Frame = +1 Query: 193 ESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENE 351 E + GT FK+F+G+L+ + TE ++ +F ++G V + ++R+ GFV ++ Sbjct: 202 ERERIGTLEFKLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVKYSSK 261 Query: 352 QVGREAIQNLNG 387 + AI LNG Sbjct: 262 ETAMAAIDGLNG 273 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 41.5 bits (93), Expect = 3e-04 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 12/114 (10%) Frame = +1 Query: 211 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYG--------FVHMENEQVGRE 366 + T K+F+G++ TE ++RP FE++G V+E ++++ FV + Sbjct: 117 SSTVKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADR 176 Query: 367 AIQNLNGEL-VHGQAIKIE---AAKSRKAPSTPTTKIFVGNLTDKTRAPEVREL 516 AI+ L+ ++ + G ++ A R+ T K+FVG+L + EV E+ Sbjct: 177 AIRALHNQITLPGGTGPVQVRYADGERERIGTLEFKLFVGSLNKQATEKEVEEI 230 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 7/72 (9%) Frame = +1 Query: 193 ESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENE 351 E + GT FK+F+G+L+ + TE ++ +F ++G V + ++R+ GFV ++ Sbjct: 202 ERERIGTLEFKLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVKYSSK 261 Query: 352 QVGREAIQNLNG 387 + AI LNG Sbjct: 262 ETAMAAIDGLNG 273 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 41.5 bits (93), Expect = 3e-04 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 2/71 (2%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREAIQNLNGELVH 399 IF+G + + DLR F ++G VV I + GFV + + +AI++LNG ++ Sbjct: 323 IFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIG 382 Query: 400 GQAIKIEAAKS 432 +++ +S Sbjct: 383 KNTVRLSWGRS 393 Score = 32.3 bits (70), Expect = 0.20 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 9/81 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLF-EKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 +F+G+LS T+ L F ++Y +V +V + YGFV +E A+ Sbjct: 204 VFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDSNTGRSKGYGFVRFGDENERSRALTE 263 Query: 379 LNGELVHGQAIKIEAAKSRKA 441 +NG + +++ A ++A Sbjct: 264 MNGAYCSNRQMRVGIATPKRA 284 Score = 31.9 bits (69), Expect = 0.26 Identities = 26/101 (25%), Positives = 43/101 (42%), Gaps = 15/101 (14%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQNL 381 +++G+L E L F G V ++RN YGFV + E +QN Sbjct: 110 LWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAAAEEVLQNY 169 Query: 382 NGELV--HGQAIKIEAA-----KSRKAPSTPTTKIFVGNLT 483 +G ++ Q +I A + R + P +FVG+L+ Sbjct: 170 SGSVMPNSDQPFRINWASFSTGEKRAVENGPDLSVFVGDLS 210 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 41.5 bits (93), Expect = 3e-04 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 7/61 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFV-----HMENEQVGREAIQ--NLN 384 +++G+L+ +TTE+DL LF +YG + + + GF H+E +EA+Q NLN Sbjct: 20 LWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFIYYRHVEEAVAAKEALQGANLN 79 Query: 385 G 387 G Sbjct: 80 G 80 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/58 (24%), Positives = 23/58 (39%) Frame = +1 Query: 319 RNYGFVHMENEQVGREAIQNLNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKT 492 RN+ V + + R+ + L G L + IKI + P T + G +T Sbjct: 399 RNFALVEFRSAEEARQCKEGLQGRLFNNPRIKIMYSNDELPPEQDDTSFYSGMKRSRT 456 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 41.5 bits (93), Expect = 3e-04 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 8/87 (9%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQNL 381 +F+ +S +TE L F +YG V++ D++ + + +V +++ +A+ L Sbjct: 23 LFVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLEL 82 Query: 382 NGELVHGQAIKIEAAKSRKAPSTPTTK 462 N +LV G+ + ++ K+ K + P TK Sbjct: 83 NAQLVDGRVVILDTTKAAK-HNPPDTK 108 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 41.1 bits (92), Expect = 4e-04 Identities = 25/98 (25%), Positives = 50/98 (51%), Gaps = 9/98 (9%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGR 363 G T KIF+G L TEA+ + F+++GT+ + ++ R +GF+ ++E+ Sbjct: 118 GARTKKIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVD 177 Query: 364 EAIQNLNGELVHGQAIKIEAAKSRKAPS-TPTTKIFVG 474 + EL +G+ ++++ A ++ S TP +G Sbjct: 178 MVLHKTFHEL-NGKMVEVKRAVPKELSSTTPNRSPLIG 214 Score = 35.9 bits (79), Expect = 0.016 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 9/90 (10%) Frame = +1 Query: 193 ESKMPGTGTF-KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHME 345 E KM K+FIG +S T E L+ F KYG +VE I+R+ +GF+ Sbjct: 5 EQKMESASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFA 64 Query: 346 NEQVGREAIQNLNGELVHGQAIKIEAAKSR 435 + V I ++ ++ G+ ++ + A R Sbjct: 65 DPSVAERVI--MDKHIIDGRTVEAKKAVPR 92 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 41.1 bits (92), Expect = 4e-04 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 5/79 (6%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDI-----VRNYGFVHMENEQVGREAIQNLNGE 390 I++GNL E ++ LF KYG VV+ D+ Y FV E+ + +AI +G Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADDAIYGRDGY 68 Query: 391 LVHGQAIKIEAAKSRKAPS 447 G +++E A + S Sbjct: 69 DFDGHHLRVELAHGGRRSS 87 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 41.1 bits (92), Expect = 4e-04 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 5/79 (6%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDI-----VRNYGFVHMENEQVGREAIQNLNGE 390 I++GNL E ++ LF KYG VV+ D+ Y FV E+ + +AI +G Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADDAIYGRDGY 68 Query: 391 LVHGQAIKIEAAKSRKAPS 447 G +++E A + S Sbjct: 69 DFDGHHLRVELAHGGRRSS 87 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 41.1 bits (92), Expect = 4e-04 Identities = 28/113 (24%), Positives = 57/113 (50%), Gaps = 8/113 (7%) Frame = +1 Query: 202 MPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQV 357 +P G+ ++FIG L E DLR L E+ G + E ++++ Y FV + + V Sbjct: 111 LPPHGS-EVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAFKTKDV 169 Query: 358 GREAIQNLNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVREL 516 ++AI+ L+ + G+ I+ ++++ ++F+GN+ E R++ Sbjct: 170 AQKAIEELHSKEFKGKTIRCSLSETK-------NRLFIGNIPKNWTEDEFRKV 215 Score = 35.5 bits (78), Expect = 0.021 Identities = 18/74 (24%), Positives = 39/74 (52%), Gaps = 6/74 (8%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV------RNYGFVHMENEQVGREAIQNLNG 387 +++ N+ + T+ L+ LF+++G V + R++GFVH +A+++ Sbjct: 294 LYVKNIPENTSTEQLKELFQRHGEVTKIVTPPGKGGKRDFGFVHYAERSSALKAVKDTER 353 Query: 388 ELVHGQAIKIEAAK 429 V+GQ +++ AK Sbjct: 354 YEVNGQPLEVVLAK 367 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 40.7 bits (91), Expect = 6e-04 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 8/83 (9%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 +++IGN+ T L L E++G V + ++ R +GF M++ + ++ Sbjct: 77 RVYIGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFATMKSVEDANAVVEK 136 Query: 379 LNGELVHGQAIKIEAAKSRKAPS 447 LNG V G+ IK+ + A S Sbjct: 137 LNGNTVEGREIKVNITEKPIASS 159 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 40.7 bits (91), Expect = 6e-04 Identities = 24/92 (26%), Positives = 48/92 (52%), Gaps = 8/92 (8%) Frame = +1 Query: 205 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVG 360 PG T KIF+G L TE+D + FE++GT + ++ R +GF+ ++E+ Sbjct: 104 PGR-TRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAV 162 Query: 361 REAIQNLNGELVHGQAIKIEAAKSRKAPSTPT 456 + + EL +G+ ++++ A ++ P+ Sbjct: 163 EKVLLKTFHEL-NGKMVEVKRAVPKELSPGPS 193 Score = 33.1 bits (72), Expect = 0.11 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 23/109 (21%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAI-- 372 K+FIG +S T E L+ F +G V+E I+ R +GFV + V I Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIVITE 66 Query: 373 -QNLNGELVHGQAI----------KIEAAKSRKAPSTP--TTKIFVGNL 480 N++G LV + + ++ + +P P T KIFVG L Sbjct: 67 KHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGL 115 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 40.7 bits (91), Expect = 6e-04 Identities = 24/92 (26%), Positives = 48/92 (52%), Gaps = 8/92 (8%) Frame = +1 Query: 205 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVG 360 PG T KIF+G L TE+D + FE++GT + ++ R +GF+ ++E+ Sbjct: 104 PGR-TRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAV 162 Query: 361 REAIQNLNGELVHGQAIKIEAAKSRKAPSTPT 456 + + EL +G+ ++++ A ++ P+ Sbjct: 163 EKVLLKTFHEL-NGKMVEVKRAVPKELSPGPS 193 Score = 33.1 bits (72), Expect = 0.11 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 23/109 (21%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAI-- 372 K+FIG +S T E L+ F +G V+E I+ R +GFV + V I Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIVITE 66 Query: 373 -QNLNGELVHGQAI----------KIEAAKSRKAPSTP--TTKIFVGNL 480 N++G LV + + ++ + +P P T KIFVG L Sbjct: 67 KHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGL 115 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 40.3 bits (90), Expect = 8e-04 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 8/87 (9%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 KIF+G L+ +T +R FE++G +VE ++ + YGFV + + A QN Sbjct: 23 KIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQN 82 Query: 379 LNGELVHGQAIKIEAAKSRKAPSTPTT 459 +N + +A A + P PT+ Sbjct: 83 MNPVIDGRRANCNLACLGAQKPRPPTS 109 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 39.9 bits (89), Expect = 0.001 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 5/88 (5%) Frame = +1 Query: 202 MPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDI-----VRNYGFVHMENEQVGRE 366 M G + I++GNL E ++ +F KYG +V+ ++ Y FV E+ + + Sbjct: 1 MSGRFSRSIYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPPRPPCYCFVEFEHSRDAED 60 Query: 367 AIQNLNGELVHGQAIKIEAAKSRKAPST 450 AI+ +G + G +++E A + S+ Sbjct: 61 AIKGRDGYNLDGCRLRVELAHGGRGQSS 88 >At4g25500.2 68417.m03674 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 309 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +1 Query: 226 IFIGNL-SDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNGELVHG 402 +F+ N +D T DL FE YG +V I RN+ F+ E ++ A+ N + Sbjct: 58 LFVINFDADNTRTRDLEKHFEPYGKIVNVRIRRNFAFIQYEAQEDATRALDASNNSKLMD 117 Query: 403 QAIKIEAA 426 + I +E A Sbjct: 118 KVISVEYA 125 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 7/63 (11%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVR-------NYGFVHMENEQVGREAIQNL 381 K+F+G L +EA+++ LF KYGT+ + I+R F+ E ++ A++++ Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYETKEQAVSAMESI 166 Query: 382 NGE 390 NG+ Sbjct: 167 NGK 169 Score = 28.3 bits (60), Expect = 3.2 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 324 K+F+G + +E+ L LF+++ V E +I+++ Sbjct: 19 KLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKD 52 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 7/63 (11%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVR-------NYGFVHMENEQVGREAIQNL 381 K+F+G L +EA+++ LF KYGT+ + I+R F+ E ++ A++++ Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYETKEQAVSAMESI 166 Query: 382 NGE 390 NG+ Sbjct: 167 NGK 169 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/73 (21%), Positives = 37/73 (50%), Gaps = 8/73 (10%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQNL 381 +FI N+ + + +L F+ +G V+ + + +GFV +++ + AI + Sbjct: 351 LFIYNIPREFGDQELAAAFQSFGIVLSAKVFVDKATGVSKCFGFVSYDSQAAAQNAIDMM 410 Query: 382 NGELVHGQAIKIE 420 NG + G+ +K++ Sbjct: 411 NGRHLGGKKLKVQ 423 Score = 28.3 bits (60), Expect = 3.2 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 324 K+F+G + +E+ L LF+++ V E +I+++ Sbjct: 19 KLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKD 52 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 38.3 bits (85), Expect = 0.003 Identities = 25/103 (24%), Positives = 49/103 (47%), Gaps = 6/103 (5%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-RNYGFVHME--NEQVGREAIQNLNGELV 396 + +GN+S + +L+ LFE++G + +N GF+ + + + + A + L +L+ Sbjct: 219 LLVGNISSNVEDYELKVLFEQFGDIQALHTACKNRGFIMVSYCDIRAAQNAARALQNKLL 278 Query: 397 HGQAIKIEAAKSRKAPSTPTTK---IFVGNLTDKTRAPEVREL 516 G + I + S++ PS T + V NL E+ L Sbjct: 279 RGTKLDIRYSISKENPSQKDTSKGALLVNNLDSSISNQELNRL 321 >At1g71800.1 68414.m08298 cleavage stimulation factor, putative similar to cleavage stimulation factor 64 kilodalton subunit GB:AAD47839 GI:5713194 from [Drosophila melanogaster], SP|P33240 Cleavage stimulation factor, 64 kDa subunit {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 461 Score = 38.3 bits (85), Expect = 0.003 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 8/79 (10%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQNL 381 +F+GN+ TE LR + + G VV +V + YGF ++E+ A +NL Sbjct: 11 VFVGNIPYDATEEQLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKDEETALSARRNL 70 Query: 382 NGELVHGQAIKIEAAKSRK 438 ++G+ ++++ A++ K Sbjct: 71 QSYEINGRQLRVDFAENDK 89 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 37.9 bits (84), Expect = 0.004 Identities = 21/83 (25%), Positives = 46/83 (55%), Gaps = 9/83 (10%) Frame = +1 Query: 205 PG-TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQV 357 PG + + KIF+G L+ TEA+ + F ++G + + ++ R +GF+ ++E+ Sbjct: 27 PGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEA 86 Query: 358 GREAIQNLNGELVHGQAIKIEAA 426 + +Q EL +G+ ++++ A Sbjct: 87 VDKVLQKTFHEL-NGKMVEVKLA 108 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 37.9 bits (84), Expect = 0.004 Identities = 21/83 (25%), Positives = 46/83 (55%), Gaps = 9/83 (10%) Frame = +1 Query: 205 PG-TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQV 357 PG + + KIF+G L+ TEA+ + F ++G + + ++ R +GF+ ++E+ Sbjct: 100 PGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEA 159 Query: 358 GREAIQNLNGELVHGQAIKIEAA 426 + +Q EL +G+ ++++ A Sbjct: 160 VDKVLQKTFHEL-NGKMVEVKLA 181 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 37.9 bits (84), Expect = 0.004 Identities = 21/83 (25%), Positives = 46/83 (55%), Gaps = 9/83 (10%) Frame = +1 Query: 205 PG-TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQV 357 PG + + KIF+G L+ TEA+ + F ++G + + ++ R +GF+ ++E+ Sbjct: 100 PGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEA 159 Query: 358 GREAIQNLNGELVHGQAIKIEAA 426 + +Q EL +G+ ++++ A Sbjct: 160 VDKVLQKTFHEL-NGKMVEVKLA 181 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 37.9 bits (84), Expect = 0.004 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 8/73 (10%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQNL 381 +F+ SD +E L+ +F ++G V I+ N YG+V +++ + A++ + Sbjct: 79 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSAVEAM 138 Query: 382 NGELVHGQAIKIE 420 NG+ G+ I ++ Sbjct: 139 NGKFFDGRFILVK 151 >At1g45100.1 68414.m05170 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Nicotiana tabacum] GI:7673355, [Cucumis sativus] GI:7528270; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 497 Score = 37.5 bits (83), Expect = 0.005 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 12/106 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQVGREAIQNLN 384 + + NLS T A ++ F VV +V N YGFV + +A++ N Sbjct: 160 VIVSNLSPLTKIAHIKGFFNGVAQVVSVRLVVNHEGKHVGYGFVEFASAYGANKALEEKN 219 Query: 385 GELVHGQAIKIEAAKSRKAP-----STPTTKIFVGNLTDKTRAPEV 507 GE +H KI K ++P + T +FV NL D + ++ Sbjct: 220 GEYLHNH--KILLMKGHESPGFAEEAAITKTLFVANLRDSIQISDI 263 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 37.5 bits (83), Expect = 0.005 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 5/72 (6%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDI-----VRNYGFVHMENEQVGREAIQNLNGE 390 I++GNL + ++ LF KYG +V+ D+ Y FV E+ + +AI +G Sbjct: 9 IYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRPPGYAFVEFEDPRDADDAIYGRDGY 68 Query: 391 LVHGQAIKIEAA 426 G +++E A Sbjct: 69 DFDGCRLRVEIA 80 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 37.1 bits (82), Expect = 0.007 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 8/76 (10%) Frame = +1 Query: 232 IGNLSDKTTEADLRPLFEKYGTVV--------ECDIVRNYGFVHMENEQVGREAIQNLNG 387 + NLS+ T E DL LF +G V + + R +GFV+ + + + AI LNG Sbjct: 217 VTNLSEDTREPDLMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNG 276 Query: 388 ELVHGQAIKIEAAKSR 435 +++E A R Sbjct: 277 YGYDNLILRVEWATPR 292 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 37.1 bits (82), Expect = 0.007 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 20/118 (16%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREAIQNL 381 K+F+ NL + D+ LF + GTV +I+ R + FV M + + + AI Sbjct: 96 KLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQKDGKNRGFAFVTMASGEEAQAAIDKF 155 Query: 382 NGELVHGQAIKIEAAKSRK-------------APSTPTTKIFVGNLTDKTRAPEVREL 516 + V G+ I + A+ K AP K++V NL K R+ +REL Sbjct: 156 DTFQVSGRIISVSFARRFKKPTPKSPNDLPSPAPGDTRHKLYVSNLAWKARSTHLREL 213 Score = 33.1 bits (72), Expect = 0.11 Identities = 26/106 (24%), Positives = 42/106 (39%), Gaps = 9/106 (8%) Frame = +1 Query: 196 SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYG-TVVECDIV--------RNYGFVHMEN 348 S PG K+++ NL+ K LR LF V +V YGFV Sbjct: 186 SPAPGDTRHKLYVSNLAWKARSTHLRELFTAADFNPVSARVVFADPEGRSSGYGFVSFAT 245 Query: 349 EQVGREAIQNLNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTD 486 + AI LNG+ + G+ I ++ + + S + N ++ Sbjct: 246 REEAENAITKLNGKEIMGRPITLKFSLRSASESEDGDSVEANNASE 291 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 37.1 bits (82), Expect = 0.007 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 9/105 (8%) Frame = +1 Query: 208 GTGTF-KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVG 360 G TF K+F+G L+ +T LR FE+YG ++E ++ + YGFV + + Sbjct: 19 GDTTFTKVFVGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAA 78 Query: 361 REAIQNLNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTR 495 R A + ++ G+ A S P P + N+ + R Sbjct: 79 RRACADPT-PIIDGRRANCNLA-SLGRPRPPLPYAVIPNMPGRLR 121 >At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing protein KIAA0332 - Homo sapiens, EMBL:AB002330 Length = 946 Score = 36.7 bits (81), Expect = 0.009 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 11/88 (12%) Frame = +1 Query: 217 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV-----------RNYGFVHMENEQVGR 363 T +++GNLS K E L F ++G + I+ RN GFV N G+ Sbjct: 178 TTNLYVGNLSPKVDENFLLRTFGRFGPIASVKIMWPRTDEEKRRQRNCGFVSFMNRADGQ 237 Query: 364 EAIQNLNGELVHGQAIKIEAAKSRKAPS 447 A + G +V+ +KI K+ PS Sbjct: 238 AAKDEMQGIIVYEYELKIGWGKAVSLPS 265 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 36.7 bits (81), Expect = 0.009 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 9/92 (9%) Frame = +1 Query: 211 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY--------GFVHMENEQVGRE 366 +G + I NL DLR FE++G + + + RNY GFV + E Sbjct: 44 SGPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAE 103 Query: 367 AIQNLNGELVHGQAIKIE-AAKSRKAPSTPTT 459 A++ +N +++ G+ I I A ++RK P T Sbjct: 104 AMKRMNHKVIGGREIAIVFAEENRKTPQEMRT 135 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 36.7 bits (81), Expect = 0.009 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 8/103 (7%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQ 375 F+IF+G+L +E DL+ +F G V E I++N F+ + + A++ Sbjct: 214 FEIFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVK 273 Query: 376 NLNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPE 504 L +++G+ + A++ +FVGN+ K PE Sbjct: 274 ELKSPMINGKKCGVTASQDNDT-------LFVGNIC-KIWTPE 308 Score = 26.6 bits (56), Expect = 9.9 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 9/98 (9%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQNL 381 IFI L E +R L + YG + + ++ RN +GFV + + + + Sbjct: 393 IFIDGLLPSWNEERVRDLLKPYGKLEKVELARNMPSARRKDFGFVTFDTHEAAVSCAKFI 452 Query: 382 -NGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKT 492 N EL G+ + AK R S P K G + ++ Sbjct: 453 NNSELGEGE----DKAKVRARLSRPLQKAGKGRQSSRS 486 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 36.7 bits (81), Expect = 0.009 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 8/58 (13%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 IF+ TT+ +L+ FE YG + EC +V + YGFV + + REA++ Sbjct: 410 IFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALK 467 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 36.3 bits (80), Expect = 0.012 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 8/71 (11%) Frame = +1 Query: 232 IGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQNLNG 387 + NLS+ T DL LF +G V C + R +GFV + + + AI LNG Sbjct: 178 VTNLSEDTRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAINKLNG 237 Query: 388 ELVHGQAIKIE 420 +++E Sbjct: 238 YGYDNLILRVE 248 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 35.9 bits (79), Expect = 0.016 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 12/75 (16%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMEN----E 351 G T KIF+G L TE + + F+++GT+ + ++ R +GF+ ++ + Sbjct: 106 GGRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVD 165 Query: 352 QVGREAIQNLNGELV 396 +V + LNG+LV Sbjct: 166 RVLHKTFHELNGKLV 180 Score = 35.5 bits (78), Expect = 0.021 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 8/79 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQN 378 K+FIG +S T E LR F YG VVE I+R+ +GF+ + V I Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-- 64 Query: 379 LNGELVHGQAIKIEAAKSR 435 ++ ++ G+ ++ + A R Sbjct: 65 MDKHIIDGRTVEAKKAVPR 83 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 35.9 bits (79), Expect = 0.016 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 12/75 (16%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMEN----E 351 G T KIF+G L TE + + F+++GT+ + ++ R +GF+ ++ + Sbjct: 106 GGRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVD 165 Query: 352 QVGREAIQNLNGELV 396 +V + LNG+LV Sbjct: 166 RVLHKTFHELNGKLV 180 Score = 35.5 bits (78), Expect = 0.021 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 8/79 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQN 378 K+FIG +S T E LR F YG VVE I+R+ +GF+ + V I Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-- 64 Query: 379 LNGELVHGQAIKIEAAKSR 435 ++ ++ G+ ++ + A R Sbjct: 65 MDKHIIDGRTVEAKKAVPR 83 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 35.9 bits (79), Expect = 0.016 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 12/75 (16%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMEN----E 351 G T KIF+G L TE + + F+++GT+ + ++ R +GF+ ++ + Sbjct: 106 GGRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVD 165 Query: 352 QVGREAIQNLNGELV 396 +V + LNG+LV Sbjct: 166 RVLHKTFHELNGKLV 180 Score = 35.5 bits (78), Expect = 0.021 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 8/79 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQN 378 K+FIG +S T E LR F YG VVE I+R+ +GF+ + V I Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-- 64 Query: 379 LNGELVHGQAIKIEAAKSR 435 ++ ++ G+ ++ + A R Sbjct: 65 MDKHIIDGRTVEAKKAVPR 83 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 35.9 bits (79), Expect = 0.016 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 8/84 (9%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQNL 381 ++IG L + L LF +G +V ++++ YGFV + Q+ A+Q + Sbjct: 482 LYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAVQAM 541 Query: 382 NGELVHGQAIKIEAAKSRKAPSTP 453 NG G+ + + A P P Sbjct: 542 NGYRFEGRTLAVRIAGKSPPPIAP 565 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 35.9 bits (79), Expect = 0.016 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 8/84 (9%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQNL 381 ++IG L + L LF +G +V ++++ YGFV + Q+ A+Q + Sbjct: 482 LYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAVQAM 541 Query: 382 NGELVHGQAIKIEAAKSRKAPSTP 453 NG G+ + + A P P Sbjct: 542 NGYRFEGRTLAVRIAGKSPPPIAP 565 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 35.9 bits (79), Expect = 0.016 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 8/72 (11%) Frame = +1 Query: 187 VSESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHM 342 V ES + IF+ L TT +L+ FE YG + EC +V + +GFV Sbjct: 152 VFESADRDSSQRNIFVRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAKGFGFVLF 211 Query: 343 ENEQVGREAIQN 378 + + R A++N Sbjct: 212 KTRKGARAALKN 223 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 35.9 bits (79), Expect = 0.016 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 8/78 (10%) Frame = +1 Query: 217 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAI 372 T KIF+G LS TTE + + FE++G + ++ R +GFV ++E E + Sbjct: 119 TKKIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSED-SVEVV 177 Query: 373 QNLNGELVHGQAIKIEAA 426 N + + ++++ A Sbjct: 178 MQSNFHELSDKRVEVKRA 195 Score = 35.1 bits (77), Expect = 0.028 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 8/52 (15%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENE 351 +K+F+G ++ +T+E L+ F +YG V+E + R +GFV N+ Sbjct: 6 YKLFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFAND 57 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 35.5 bits (78), Expect = 0.021 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 8/86 (9%) Frame = +1 Query: 202 MPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQV 357 +P G+ ++++G + TE DL+ G V E I+R Y FV ++ + Sbjct: 87 LPPHGS-EVYLGGIPTDATEGDLKGFCGSIGEVTEVRIMREKDSGDGKGYAFVTFRSKDL 145 Query: 358 GREAIQNLNGELVHGQAIKIEAAKSR 435 EAI LN G+ IK +++ Sbjct: 146 AAEAIDTLNNTDFRGKRIKCSTTQAK 171 Score = 30.7 bits (66), Expect = 0.61 Identities = 22/88 (25%), Positives = 36/88 (40%), Gaps = 8/88 (9%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQNL 381 ++I NL T+ L+ LFE +G +++ I YGFVH A++N Sbjct: 270 LYIKNLPRDITQERLKALFEHHGKILKVVIPPAKPGKEDSRYGFVHYAERTSVMRALKNT 329 Query: 382 NGELVHGQAIKIEAAKSRKAPSTPTTKI 465 + G + AK + T T + Sbjct: 330 ERYEIDGHMLDCTLAKPQADQKTNTNTV 357 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 35.5 bits (78), Expect = 0.021 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 20/118 (16%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQN 378 K+++ +S TE D+R +FEKYG V E + ++ Y F+ + + G AI Sbjct: 111 KLYVAPISKTATEYDIRQVFEKYGNVTEIILPKDKMTGERAAYCFIKYKKVEEGNAAIAA 170 Query: 379 LN------GELVHGQAIKIEAAKSR------KAPSTPTTKIFVGNLTDKTRAPEVREL 516 L GE++ + EA + R + P P K++V L +T EV E+ Sbjct: 171 LTEQFTFPGEMLPVKVRFAEAERERIGFAPVQLPDNP--KLYVRCLNKQTTKMEVNEV 226 Score = 32.3 bits (70), Expect = 0.20 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 7/62 (11%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVEC-------DIVRNYGFVHMENEQVGREAIQNL 381 K+++ L+ +TT+ ++ +F +YG + + I R Y FV +++ AI+ L Sbjct: 208 KLYVRCLNKQTTKMEVNEVFSRYGIIEDIYMALDDMKICRGYAFVQFSCKEMALAAIKAL 267 Query: 382 NG 387 NG Sbjct: 268 NG 269 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 35.5 bits (78), Expect = 0.021 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 10/92 (10%) Frame = +1 Query: 193 ESKMPGTGT-FKIFIGNLSDKTTEADLRPLF-EKYGTVVECDIV--------RNYGFVHM 342 E ++ G IF+G+LS ++ L F EKY +V +V + YGFV Sbjct: 187 EKRLENNGPDLSIFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRF 246 Query: 343 ENEQVGREAIQNLNGELVHGQAIKIEAAKSRK 438 +E +A+ +NG +A++I A RK Sbjct: 247 GDENERTKAMTEMNGVKCSSRAMRIGPATPRK 278 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 35.1 bits (77), Expect = 0.028 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 8/90 (8%) Frame = +1 Query: 187 VSESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-----YGFVHMENE 351 VS ++ + I++GN+ T +++ F+ GTV I+ + GF ++E Sbjct: 92 VSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAYVEFV 151 Query: 352 QVGREAIQN---LNGELVHGQAIKIEAAKS 432 +V EA+QN LN +HG+ IK+ A ++ Sbjct: 152 EV--EAVQNSLILNESELHGRQIKVSAKRT 179 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 35.1 bits (77), Expect = 0.028 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +1 Query: 217 TFKIFIGNLSD-KTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNGEL 393 T +F+ N +T E D+ FE YG V+ + RN+ FV ++ +A+ + + Sbjct: 68 TKTLFVINFDPIRTRERDMERHFEPYGKVLNVRMRRNFAFVQFATQEDATKALDSTHNSK 127 Query: 394 VHGQAIKIEAA 426 + + + +E A Sbjct: 128 LLDKVVSVEYA 138 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 35.1 bits (77), Expect = 0.028 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 9/86 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+F+G L+ +T ++R FE++G ++E I+ + YGFV A+ + Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVAD 77 Query: 379 LNGELVHGQAIKIEAAK-SRKAPSTP 453 N ++ G+ A R PS P Sbjct: 78 PN-PVIDGRKANCNIASFGRPRPSPP 102 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 35.1 bits (77), Expect = 0.028 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 9/86 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+F+G L+ +T ++R FE++G ++E I+ + YGFV A+ + Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVAD 77 Query: 379 LNGELVHGQAIKIEAAK-SRKAPSTP 453 N ++ G+ A R PS P Sbjct: 78 PN-PVIDGRKANCNIASFGRPRPSPP 102 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 34.7 bits (76), Expect = 0.037 Identities = 16/64 (25%), Positives = 34/64 (53%), Gaps = 8/64 (12%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQNL 381 +F+ SD +E L+ +F ++G V I+ N YG+V +++ + A++ + Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSAVEAM 119 Query: 382 NGEL 393 NG++ Sbjct: 120 NGKV 123 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 34.7 bits (76), Expect = 0.037 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 9/81 (11%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTV--------VECDIVRNYGFVHMENEQVGR 363 G K+++GNL +E LR +FE +G V E + +GF+ + + Sbjct: 261 GPADRKLYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQFVQLEHSK 320 Query: 364 EAIQNLNGEL-VHGQAIKIEA 423 A LNG+L + G+ IK+ + Sbjct: 321 AAQIALNGKLEIAGRTIKVSS 341 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 34.7 bits (76), Expect = 0.037 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 8/83 (9%) Frame = +1 Query: 217 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAI 372 T KIF+G L T+ + R FE YG V + I+ R +GFV ++E + Sbjct: 109 TKKIFVGGLPPTLTDEEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVL 168 Query: 373 QNLNGELVHGQAIKIEAAKSRKA 441 +L G+ ++++ A + A Sbjct: 169 HKTFHDL-SGKQVEVKRALPKDA 190 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 324 K+F+G +S +T E LR F YG V + ++R+ Sbjct: 7 KLFVGGISWETDEDKLREHFTNYGEVSQAIVMRD 40 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 34.7 bits (76), Expect = 0.037 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 9/63 (14%) Frame = +1 Query: 208 GTGTF-KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVG 360 G TF K+F+G L+ +T LR F++YG ++E ++ + YGFV + + Sbjct: 19 GDTTFTKVFVGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAA 78 Query: 361 REA 369 R A Sbjct: 79 RRA 81 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 34.3 bits (75), Expect = 0.049 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 11/95 (11%) Frame = +1 Query: 202 MPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQV 357 M T K+F+G L+ +T + LR FE++G +VE ++ + YGFV + + Sbjct: 1 MEDTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEA 60 Query: 358 GREAIQNLNGELVHGQAIKIEAAK---SRKAPSTP 453 ++A + ++ G+ A R PS+P Sbjct: 61 AQKACVD-PAPVIDGRRANCNLAAFGVQRSKPSSP 94 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 34.3 bits (75), Expect = 0.049 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 11/95 (11%) Frame = +1 Query: 202 MPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQV 357 M T K+F+G L+ +T + LR FE++G +VE ++ + YGFV + + Sbjct: 1 MEDTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEA 60 Query: 358 GREAIQNLNGELVHGQAIKIEAAK---SRKAPSTP 453 ++A + ++ G+ A R PS+P Sbjct: 61 AQKACVD-PAPVIDGRRANCNLAAFGVQRSKPSSP 94 >At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 823 Score = 33.9 bits (74), Expect = 0.065 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 3/77 (3%) Frame = +1 Query: 226 IFIG-NLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREAIQNLNGELV 396 ++IG S K +A LR +F +G + + + R+Y FV N +A ++L G+L Sbjct: 153 LYIGFPASLKVDDALLRNVFSSFGEITKVTVFPGRSYAFVQFRNLMAACKAKESLQGKLF 212 Query: 397 HGQAIKIEAAKSRKAPS 447 + I AKS + S Sbjct: 213 GNPRVHICFAKSEPSSS 229 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 33.9 bits (74), Expect = 0.065 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 11/88 (12%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+F+G L+ +T + ++ FE++G ++E ++ + YGFV + R A + Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVD 73 Query: 379 LNGELVHGQAIKIEAAK---SRKAPSTP 453 ++ G+ A R PSTP Sbjct: 74 AT-PVIDGRRANCNLASLGLQRSKPSTP 100 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 33.9 bits (74), Expect = 0.065 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 11/88 (12%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+F+G L+ +T + ++ FE++G ++E ++ + YGFV + R A + Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVD 73 Query: 379 LNGELVHGQAIKIEAAK---SRKAPSTP 453 ++ G+ A R PSTP Sbjct: 74 AT-PVIDGRRANCNLASLGLQRSKPSTP 100 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 33.9 bits (74), Expect = 0.065 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 11/88 (12%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 K+F+G L+ +T + ++ FE++G ++E ++ + YGFV + R A + Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVD 73 Query: 379 LNGELVHGQAIKIEAAK---SRKAPSTP 453 ++ G+ A R PSTP Sbjct: 74 AT-PVIDGRRANCNLASLGLQRSKPSTP 100 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 33.9 bits (74), Expect = 0.065 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 7/62 (11%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVR-----NYG--FVHMENEQVGREAIQNL 381 K+F+G L +E +++ LF +YGT+ + I+R + G F+ E+++ A++ L Sbjct: 110 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAMEAL 169 Query: 382 NG 387 NG Sbjct: 170 NG 171 Score = 31.5 bits (68), Expect = 0.35 Identities = 17/85 (20%), Positives = 40/85 (47%), Gaps = 8/85 (9%) Frame = +1 Query: 190 SESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHME 345 S + G +FI N+ + + +L F+ +G V+ + + +GF+ + Sbjct: 329 SSLQTEGPAGANLFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYD 388 Query: 346 NEQVGREAIQNLNGELVHGQAIKIE 420 ++ + AI +NG + G+ +K++ Sbjct: 389 SQAAAQNAINTMNGCQLSGKKLKVQ 413 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 33.9 bits (74), Expect = 0.065 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 7/62 (11%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVR-----NYG--FVHMENEQVGREAIQNL 381 K+F+G L +E +++ LF +YGT+ + I+R + G F+ E+++ A++ L Sbjct: 101 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAMEAL 160 Query: 382 NG 387 NG Sbjct: 161 NG 162 Score = 31.5 bits (68), Expect = 0.35 Identities = 17/85 (20%), Positives = 40/85 (47%), Gaps = 8/85 (9%) Frame = +1 Query: 190 SESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHME 345 S + G +FI N+ + + +L F+ +G V+ + + +GF+ + Sbjct: 320 SSLQTEGPAGANLFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYD 379 Query: 346 NEQVGREAIQNLNGELVHGQAIKIE 420 ++ + AI +NG + G+ +K++ Sbjct: 380 SQAAAQNAINTMNGCQLSGKKLKVQ 404 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 33.5 bits (73), Expect = 0.086 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +1 Query: 193 ESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY 327 E + P +IF+ + +E+D R FE+YG + + + ++Y Sbjct: 82 EMRQPAKKVTRIFVARIPSSVSESDFRSHFERYGEITDLYMPKDY 126 Score = 27.5 bits (58), Expect = 5.7 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 8/76 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 KIF+G L + + DLR F ++G + + I R +GFV V + + Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVA-DRVAR 299 Query: 379 LNGELVHGQAIKIEAA 426 + E+ GQ + I++A Sbjct: 300 RSHEIC-GQEVAIDSA 314 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 33.5 bits (73), Expect = 0.086 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 12/104 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY--------GFVHMENEQVGREAIQNL 381 + + NL + DLR FE++G V + + R+Y GF+ + EA + Sbjct: 39 LLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQFMDPADAAEAKHQM 98 Query: 382 NGELVHGQAIKIE-AAKSRKAPSTPTTKIFVG---NLTDKTRAP 501 +G L+ G+ + + A ++RK P+ T+ G D+ R+P Sbjct: 99 DGYLLLGRELTVVFAEENRKKPTEMRTRDRGGRSNRFQDRRRSP 142 >At3g10845.1 68416.m01306 RNA recognition motif (RRM)-containing protein similar to SP|P42731 Polyadenylate-binding protein 2 (Poly(A) binding protein 2) (PABP 2) {Arabidopsis thaliana}; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 423 Score = 33.5 bits (73), Expect = 0.086 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 7/69 (10%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY-------GFVHMENEQVGREAIQNLN 384 +F+ NLS +T D+ + G VV ++ N+ FV + ++ ++N N Sbjct: 129 LFVANLSPQTKILDIFGFCQDVGEVVSVRLIANHEDKPVGCAFVEFLSANEAKKVLENKN 188 Query: 385 GELVHGQAI 411 GE HG I Sbjct: 189 GEYFHGHKI 197 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 33.5 bits (73), Expect = 0.086 Identities = 27/101 (26%), Positives = 47/101 (46%), Gaps = 13/101 (12%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 KIF+ L +TT L +FE YG + EC +V + +GFV + + +EA++ Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKE 164 Query: 379 LNGELVHG----QAIKIEAAKSRKAPSTP-TTKIFVGNLTD 486 +++ Q + A S K P KI +G++ + Sbjct: 165 PKKRILNRTATCQLASMGPAASGKGHDQPGPVKISMGSMAN 205 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 33.5 bits (73), Expect = 0.086 Identities = 27/101 (26%), Positives = 47/101 (46%), Gaps = 13/101 (12%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQN 378 KIF+ L +TT L +FE YG + EC +V + +GFV + + +EA++ Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKE 164 Query: 379 LNGELVHG----QAIKIEAAKSRKAPSTP-TTKIFVGNLTD 486 +++ Q + A S K P KI +G++ + Sbjct: 165 PKKRILNRTATCQLASMGPAASGKGHDQPGPVKISMGSMAN 205 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 33.1 bits (72), Expect = 0.11 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 12/72 (16%) Frame = +1 Query: 217 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQ----VG 360 T KIF+G L T + R FE YG V + I+ R +GFV ++E V Sbjct: 109 TKKIFVGGLPPALTSDEFRAYFETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVL 168 Query: 361 REAIQNLNGELV 396 + +LNG+ V Sbjct: 169 HKTFHDLNGKQV 180 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 33.1 bits (72), Expect = 0.11 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 10/102 (9%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY--------GFVHMENEQVGREAIQNL 381 + + NL + DLR FE++G V + + R+Y GFV + +A ++ Sbjct: 38 LLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQFMDPADAADAKHHM 97 Query: 382 NGELVHGQAIKIE-AAKSRKAPSTPTTK-IFVGNLTDKTRAP 501 +G L+ G+ + + A ++RK P+ + G D+ R P Sbjct: 98 DGYLLLGRELTVVFAEENRKKPTEMRARERGGGRFRDRRRTP 139 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 32.3 bits (70), Expect = 0.20 Identities = 31/121 (25%), Positives = 51/121 (42%), Gaps = 14/121 (11%) Frame = +1 Query: 190 SESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHME 345 S S M G K+F+G +S +TT F K+G VV+ I+ R +GFV Sbjct: 58 SSSSMSSPG--KLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTFA 115 Query: 346 NEQVGREAIQNLNGELVHGQAIKIEAAKSRKAPST------PTTKIFVGNLTDKTRAPEV 507 + V + ++ ++ + + ++ R T T KIFVG L E+ Sbjct: 116 DSAVAEKVLE--EDHVIDDRKVDLKRTLPRGDKDTDIKAVSKTRKIFVGGLPPLLEEDEL 173 Query: 508 R 510 + Sbjct: 174 K 174 Score = 28.7 bits (61), Expect = 2.5 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 8/53 (15%) Frame = +1 Query: 217 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENE 351 T KIF+G L E +L+ F YG ++E I+ R +GFV + E Sbjct: 156 TRKIFVGGLPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTE 208 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 31.9 bits (69), Expect = 0.26 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENE 351 F ++GNL T E DL+ F ++G V+ ++ ++ F ++ E Sbjct: 8 FTCYVGNLESDTEENDLKNAFSQFGDVIHSNVRFSFHFSLIDYE 51 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 31.5 bits (68), Expect = 0.35 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREAIQNLNGELV- 396 +++G L+ + E D+R F +G + I+ + FV + + +A Q L+ LV Sbjct: 230 LYVGGLNSRILEQDIRDQFYAHGEIESIRILADKACAFVTYTSREGAEKAAQELSNRLVI 289 Query: 397 HGQAIKI 417 +GQ +K+ Sbjct: 290 NGQRLKL 296 >At1g43190.1 68414.m04977 polypyrimidine tract-binding protein, putative / heterogeneous nuclear ribonucleoprotein, putative similar to Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) from {Rattus norvegicus} SP|Q00438, {Homo sapiens} SP|P26599, [Homo sapiens] GI:35770; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 432 Score = 31.1 bits (67), Expect = 0.46 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = +1 Query: 226 IFIGNLS-DKTTEADLRPLFEKYGTVVECDIVRN---YGFVHMENEQVGREAIQNLNGEL 393 + + NL+ D E L LF YG +V ++RN + V M + A+ L G + Sbjct: 247 VLVSNLNADSIDEDKLFNLFSLYGNIVRIKLLRNKPDHALVQMGDGFQAELAVHFLKGAM 306 Query: 394 VHGQAIKIEAAK 429 + G+ +++ +K Sbjct: 307 LFGKRLEVNFSK 318 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 30.7 bits (66), Expect = 0.61 Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 8/72 (11%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQNL 381 ++IG + E ++ F ++GTV + RN +GF+ E+ +V A + Sbjct: 62 LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAEIAAGAM 121 Query: 382 NGELVHGQAIKI 417 N L+ +K+ Sbjct: 122 NDYLLMEHMLKV 133 >At5g65260.1 68418.m08209 polyadenylate-binding protein family protein / PABP family protein low similarity to poly(A)-binding protein II [Drosophila melanogaster] GI:6007612; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 220 Score = 30.3 bits (65), Expect = 0.80 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 7/90 (7%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-----YGFVHMENEQVG--REAIQNLN 384 +F+GN+ T +++ F+ GTV I+ + GF ++E +V +EA+Q LN Sbjct: 94 VFVGNVDYACTPEEVQQHFQTCGTVHRVTILTDKFGQPKGFAYVEFVEVEAVQEALQ-LN 152 Query: 385 GELVHGQAIKIEAAKSRKAPSTPTTKIFVG 474 +HG+ +K+ +K + P K F G Sbjct: 153 ESELHGRQLKV----LQKRTNVPGLKQFRG 178 >At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 483 Score = 30.3 bits (65), Expect = 0.80 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREAIQNLNGEL-V 396 +++G L+ + E D+R F +G + I+ + FV + +A + L+ L V Sbjct: 230 LYVGGLNSRVLEQDIRDQFYAHGEIESIRILAEKACAFVTYTTREGAEKAAEELSNRLVV 289 Query: 397 HGQAIKI 417 +GQ +K+ Sbjct: 290 NGQRLKL 296 >At5g49000.1 68418.m06062 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 372 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 203 ILDSETHTFHEMSQQRLKRWYFSENI 126 ILD +HT+HE R+KR Y + N+ Sbjct: 149 ILDCRSHTWHEAPSMRMKRNYPAANV 174 >At3g48830.1 68416.m05333 polynucleotide adenylyltransferase family protein / RNA recognition motif (RRM)-containing protein similar to SP|P13685 Poly(A) polymerase (EC 2.7.7.19) {Escherichia coli O157:H7}; contains Pfam profiles PF01743: polyA polymerase family protein, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 881 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +1 Query: 325 YGFVHMENEQVGREAIQNLNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDK 489 YGFV + + A++ NGE +H I + AK+ AP P K NL +K Sbjct: 724 YGFVEFASPCLANMALEKKNGEYLHDHKIFLGVAKT--APYPPRIKY---NLAEK 773 >At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing protein similar to ssRNA-binding protein [Dictyostelium discoideum] GI:1546894; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/74 (24%), Positives = 36/74 (48%), Gaps = 8/74 (10%) Frame = +1 Query: 220 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQVGREAIQ 375 +++F G+L ++ + L F ++ T ++R+ YGFV N A++ Sbjct: 137 YRLFCGDLGNEVNDDVLSKAFARFPTFNMAKVIRDKRTGKTKGYGFVSFLNPADLAAALK 196 Query: 376 NLNGELVHGQAIKI 417 +NG+ V + IK+ Sbjct: 197 EMNGKYVGNRPIKL 210 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 29.5 bits (63), Expect = 1.4 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 8/84 (9%) Frame = +1 Query: 214 GTFKIFIGNLSDKTTEADLRPLFE-------KYGTVVECDIVRNYGFVHMENEQVGREAI 372 G +++IGNL+ TTE D+R LF + G E + Y V + + V Sbjct: 260 GYNRVYIGNLAWDTTERDIRKLFSDCVINSVRLGKNKETGEFKGYAHVDFK-DSVSVAIA 318 Query: 373 QNLNGELVHGQAIKIEAA-KSRKA 441 L+ +++ G+ +KI A K R A Sbjct: 319 LKLDQQVICGRPVKICCALKDRPA 342 >At1g09230.1 68414.m01030 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 442 Score = 29.5 bits (63), Expect = 1.4 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 4/71 (5%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGT--VVECD--IVRNYGFVHMENEQVGREAIQNLNGEL 393 + + +L D + LF +YG V C +RN FV +NE +A + LNG Sbjct: 30 LLVRHLPDGIPHDIVSRLFSQYGASAVRPCSGGKLRNAAFVDFKNEAFASQAHRQLNGLR 89 Query: 394 VHGQAIKIEAA 426 G+ ++++ A Sbjct: 90 FLGKVLQVQRA 100 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 29.1 bits (62), Expect = 1.9 Identities = 26/99 (26%), Positives = 43/99 (43%), Gaps = 13/99 (13%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFV---HMENEQVG-RE 366 K+FI L+ TT LR LF YG + E ++ + YGFV H++ + +E Sbjct: 76 KLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKE 135 Query: 367 AIQNLNGELVHGQ-AIKIEAAKSRKAPSTPTTKIFVGNL 480 + ++G + Q A + KI+V N+ Sbjct: 136 PSKKIDGRVTVTQLAASGNQGTGSQIADISMRKIYVANV 174 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 29.1 bits (62), Expect = 1.9 Identities = 26/99 (26%), Positives = 43/99 (43%), Gaps = 13/99 (13%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFV---HMENEQVG-RE 366 K+FI L+ TT LR LF YG + E ++ + YGFV H++ + +E Sbjct: 76 KLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKE 135 Query: 367 AIQNLNGELVHGQ-AIKIEAAKSRKAPSTPTTKIFVGNL 480 + ++G + Q A + KI+V N+ Sbjct: 136 PSKKIDGRVTVTQLAASGNQGTGSQIADISMRKIYVANV 174 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 214 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 324 G +IF+G L TE+ +R L E +G + D+V++ Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKD 393 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 214 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 324 G +IF+G L TE+ +R L E +G + D+V++ Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKD 393 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 214 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 324 G +IF+G L TE+ +R L E +G + D+V++ Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKD 393 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 28.7 bits (61), Expect = 2.5 Identities = 24/102 (23%), Positives = 49/102 (48%), Gaps = 12/102 (11%) Frame = +1 Query: 178 NVCVSESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGF 333 N C ++K+ K+F+G L+ T + + F KYG ++E I+ + YGF Sbjct: 8 NGCFGDTKLT-----KVFVGGLAWDTHKEAMYDHFIKYGDILEAVIISDKLTRRSKGYGF 62 Query: 334 VHMENEQVGREAIQNLNGELVHGQAIKIEAA----KSRKAPS 447 V ++ + A ++ + +++G+ A + RK+P+ Sbjct: 63 VTFKDAKAATRACED-STPIINGRRANCNLASLGGRLRKSPT 103 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 28.7 bits (61), Expect = 2.5 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 9/92 (9%) Frame = +1 Query: 190 SESKMPGTGTFKIFIGNLSDKTTEADLRPLFE-KYGTVVECDIV--------RNYGFVHM 342 S K + + IF+G+L+ T+ L F Y +V +V + YGFV Sbjct: 145 SGDKRDDSPDYTIFVGDLAADVTDYILLETFRASYPSVKGAKVVIDRVTGRTKGYGFVRF 204 Query: 343 ENEQVGREAIQNLNGELVHGQAIKIEAAKSRK 438 +E A+ +NG + ++I A S+K Sbjct: 205 SDESEQIRAMTEMNGVPCSTRPMRIGPAASKK 236 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENE 351 +F+G L T+ L+ +F +YG +V I + GFV + Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEK 306 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 28.7 bits (61), Expect = 2.5 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 7/70 (10%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV------RNYGFVHME-NEQVGREAIQNL 381 K+++GNL T LR F K+GT+V ++ RN F + R+A + Sbjct: 213 KVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALSF 272 Query: 382 NGELVHGQAI 411 NG G+ I Sbjct: 273 NGTQYEGRRI 282 >At4g39550.1 68417.m05592 kelch repeat-containing F-box family protein similar to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 392 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -2 Query: 212 VPGILDSETHTFHEMSQQRLKRWYFSENINE 120 + +LD ++HT+HE R++R Y + N+ E Sbjct: 163 IVSVLDCQSHTWHEGPGMRVERRYPAANVVE 193 >At4g22200.1 68417.m03209 potassium channel protein 2 (AKT2) (AKT3) identical to potassium channel [Arabidopsis thaliana] gi|1100898|gb|AAA97865; Note: also identical to AKT3 [Arabidopsis thaliana] gi|1172218|gb|AAA96153, which is a truncated version of AKT2, PMID:10852932; member of the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+ channel family, PMID:11500563; identical to cDNA inward-rectifying K+ channel (AKT3) GI:1172219 Length = 802 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 15 WSLFGVHIFNLCYILLFFVHSNPCKYY 95 +S F + F L + LF VH C YY Sbjct: 209 YSYFWIRCFRLLSVTLFLVHCAGCSYY 235 >At5g25790.1 68418.m03061 tesmin/TSO1-like CXC domain-containing protein similar to SP|Q9Y4I5 Tesmin (Metallothionein-like 5, testis-specific) {Homo sapiens}; contains Pfam profile PF03638: Tesmin/TSO1-like CXC domain Length = 408 Score = 27.9 bits (59), Expect = 4.3 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +2 Query: 143 TIASDAADSFREMYAFQNLKCRAPVLSKSSSGTFLIKPQKPILDRYSKNTVR 298 +I ++ DSF++ + + C +PV S S T + PQKP L ++ N V+ Sbjct: 17 SIPAEKMDSFQK--SLEPPPC-SPVKSSQQSETEVTPPQKPPLHQFGHNQVQ 65 >At2g30260.1 68415.m03684 small nuclear ribonucleoprotein U2B, putative / spliceosomal protein, putative similar to spliceosomal protein [Solanum tuberosum] GI:169589 Length = 232 Score = 27.9 bits (59), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTVVE---CDIVRNYGFVHMENEQVGREAIQNLNG 387 +FI NL +TT L+ LFE+Y E D FV E++ A+Q L G Sbjct: 160 LFIQNLPHETTSMMLQLLFEQYPGFKEIRMIDAKPGIAFVEYEDDVQASIAMQPLQG 216 >At1g67140.1 68414.m07638 expressed protein Length = 2158 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 55 YCYSLYIVTHVSIISNFIYPVYSLIFSEKYHRFR 156 + ++ I+ H N++YPV SLIF + FR Sbjct: 910 FLFATIILIHCYYYMNYLYPVSSLIFIVNLNIFR 943 >At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 27.9 bits (59), Expect = 4.3 Identities = 17/77 (22%), Positives = 39/77 (50%), Gaps = 3/77 (3%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTV-VECDIVRNYGFVHMENEQV--GREAIQNLNGELV 396 +F+ N++ +++L LFE+YG + ++ GFV + + R A+++L + + Sbjct: 170 LFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHRGFVMISYYDIRSARMAMRSLQNKPL 229 Query: 397 HGQAIKIEAAKSRKAPS 447 + + I + + PS Sbjct: 230 RRRKLDIHFSIPKDNPS 246 >At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 27.9 bits (59), Expect = 4.3 Identities = 17/77 (22%), Positives = 39/77 (50%), Gaps = 3/77 (3%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTV-VECDIVRNYGFVHMENEQV--GREAIQNLNGELV 396 +F+ N++ +++L LFE+YG + ++ GFV + + R A+++L + + Sbjct: 170 LFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHRGFVMISYYDIRSARMAMRSLQNKPL 229 Query: 397 HGQAIKIEAAKSRKAPS 447 + + I + + PS Sbjct: 230 RRRKLDIHFSIPKDNPS 246 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 178 NVCVSESKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVE 306 N ++S + G +F+G L TT+A++ + +YG V E Sbjct: 188 NKSPTQSFVVDNGNTMLFVGELHWWTTDAEIESVLSQYGRVKE 230 >At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing protein Length = 710 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVE 306 G G F +F+G+L TT+A+L KYG V E Sbjct: 231 GGGAF-LFVGDLHWWTTDAELEAELCKYGAVKE 262 >At5g14690.1 68418.m01721 expressed protein predicted protein, Arabidopsis thaliana Length = 217 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 319 RNYGFVHMENEQVGREAIQNLNGELVHGQAIKIEAAKSR 435 RN+G H +N+ V E + + HG +K + + R Sbjct: 11 RNHGGTHCQNDAVDEENRRRRHNHHTHGDEVKCSSKRCR 49 >At1g59740.1 68414.m06726 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 591 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 84 CKYYFKFHLSRVLVNILGKIPS 149 C Y F F+ S VLV+++ KI S Sbjct: 509 CSYSFGFYFSSVLVSVVNKITS 530 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/73 (23%), Positives = 39/73 (53%), Gaps = 8/73 (10%) Frame = +1 Query: 226 IFIGNLSDKTTEADLRPLFEKYGTV--VECDIVRN------YGFVHMENEQVGREAIQNL 381 ++IGN+S TTE L LF + G + + + +N + FV + + +A++ + Sbjct: 36 VYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLDKNTKTPCGFCFVLFYSREDTEDAVKYI 95 Query: 382 NGELVHGQAIKIE 420 +G ++ + I+++ Sbjct: 96 SGTILDDRPIRVD 108 >At4g08450.1 68417.m01393 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1234 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +1 Query: 70 YIVTHVSIISNFIYPVYSLIFSEKYHRFRRC 162 + TH +I S+ P+ ++ S++Y RF+ C Sbjct: 979 FYFTHQTIGSSIGIPLLHILLSQQYFRFKAC 1009 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 27.1 bits (57), Expect = 7.5 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 9/94 (9%) Frame = +1 Query: 208 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY--------GFVHMENEQVGR 363 G+ + + N+ +LR FE++G V + I R+Y FV + Sbjct: 43 GSSHGSLLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAG 102 Query: 364 EAIQNLNGELVHGQAIK-IEAAKSRKAPSTPTTK 462 EA +++N G+ I + A++SRK P K Sbjct: 103 EAQRSMNRRSFAGREITVVVASESRKRPEEMRVK 136 >At1g55290.1 68414.m06316 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to GI:5924383 from [Daucus carota]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 361 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 265 DLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNL 381 D+ L EK + CD +GF + N V E ++N+ Sbjct: 66 DISNLDEKSVSKAVCDAAEEWGFFQVINHGVSMEVLENM 104 >At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 WD-40 repeats (PF0400); similar to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 496 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 406 AIKIEAAKSRKAPSTPTTKIFVGNLTDKTR 495 A ++A + R+AP TP T I LTDK R Sbjct: 6 AATVQATRPRRAPRTPVTAI----LTDKRR 31 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 8/59 (13%) Frame = +1 Query: 223 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREAIQ 375 KIF+ L T L F++YG + +C V + YGF+ ++ R A++ Sbjct: 129 KIFVHGLGWDTKADSLIDAFKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNALK 187 >At1g73660.1 68414.m08530 protein kinase family protein contains Pfam profile: PF00069 eukaryotic protein kinase domain Length = 1030 Score = 26.6 bits (56), Expect = 9.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 405 GDQNRSGQEPEGAVDANH 458 GD G EP+G+ D+NH Sbjct: 695 GDDGSGGHEPQGSGDSNH 712 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 26.6 bits (56), Expect = 9.9 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +2 Query: 311 ISSEITVSCTWKTNKSAAKPF 373 + +E+ S T+KTNK ++PF Sbjct: 576 VEAEVVTSLTFKTNKRTSQPF 596 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 26.6 bits (56), Expect = 9.9 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +2 Query: 311 ISSEITVSCTWKTNKSAAKPF 373 + +E+ S T+KTNK ++PF Sbjct: 576 VEAEVVTSLTFKTNKRTSQPF 596 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,782,618 Number of Sequences: 28952 Number of extensions: 212767 Number of successful extensions: 886 Number of sequences better than 10.0: 176 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -