BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30537 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 25 0.53 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 21 8.6 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 24.6 bits (51), Expect = 0.53 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +3 Query: 306 MERMLQPCGPPPEKPED 356 ME L PC P KP+D Sbjct: 126 METTLTPCASPNRKPDD 142 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +1 Query: 67 TISTSILPLKIKWVKDTTFTVNLNIYRANI*AQATP 174 T+S + P +W++D + I +I A+ +P Sbjct: 175 TVSIDVFPAVARWMQDPKTNHGILIVVYSIGAKKSP 210 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,977 Number of Sequences: 336 Number of extensions: 2147 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -