BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30537 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 6.1 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 8.1 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 8.1 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 8.1 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 8.1 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 6.1 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -2 Query: 326 WLKHSFHQIEFYARFRFIFYDRKVTQQIRMTHVAAARVA 210 W K + H E++A FY+ +TQ +HV + VA Sbjct: 1741 WTKLTSHLKEYFA-----FYENFITQVHGTSHVMSGMVA 1774 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 264 SQSNSTNPDDPCSCSKSRDVG 202 S +NS NP P +C++ R+ G Sbjct: 28 SCNNSLNPRTPPNCARCRNHG 48 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 264 SQSNSTNPDDPCSCSKSRDVG 202 S +NS NP P +C++ R+ G Sbjct: 28 SCNNSLNPRTPPNCARCRNHG 48 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 264 SQSNSTNPDDPCSCSKSRDVG 202 S +NS NP P +C++ R+ G Sbjct: 28 SCNNSLNPRTPPNCARCRNHG 48 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 264 SQSNSTNPDDPCSCSKSRDVG 202 S +NS NP P +C++ R+ G Sbjct: 28 SCNNSLNPRTPPNCARCRNHG 48 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 468,850 Number of Sequences: 2352 Number of extensions: 9039 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -