BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30537 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14342.1 68417.m02209 pre-mRNA splicing factor 10 kDa subunit... 120 4e-28 At3g23325.1 68416.m02942 splicing factor, putative similar to Sp... 119 1e-27 At1g70560.1 68414.m08123 alliinase C-terminal domain-containing ... 27 5.7 At3g53360.1 68416.m05889 pentatricopeptide (PPR) repeat-containi... 27 9.9 At3g48200.1 68416.m05259 expressed protein 27 9.9 >At4g14342.1 68417.m02209 pre-mRNA splicing factor 10 kDa subunit, putative similar to Splicing factor 3B subunit 10 (SF3b10) (Pre-mRNA splicing factor SF3b 10 kDa subunit) (Swiss-Prot:Q9BWJ5) [Homo sapiens]; Conserved in Plasmodium, yeast, fly, mouse, human Length = 87 Score = 120 bits (290), Expect = 4e-28 Identities = 50/83 (60%), Positives = 67/83 (80%) Frame = +3 Query: 108 ERYNIHSQLEHLQSKYIGTGHADTTKYEWLMNQHRDSCCSYMGHPDLLSYFAIVENESKA 287 +R+NI+SQLEHLQ+KY+GTGHAD +++EW +N RDS SY+GH +LSYFAI ENES Sbjct: 5 DRFNINSQLEHLQAKYVGTGHADLSRFEWAVNIQRDSYASYIGHYPMLSYFAIAENESIG 64 Query: 288 RVKFNLMERMLQPCGPPPEKPED 356 R ++N M++ML PCG PPE+ E+ Sbjct: 65 RERYNFMQKMLLPCGLPPEREEE 87 >At3g23325.1 68416.m02942 splicing factor, putative similar to Splicing factor 3B subunit 10 (SF3b10) (Pre-mRNA splicing factor SF3b 10 kDa subunit) (Swiss-Prot:Q9BWJ5) [Homo sapiens] Length = 87 Score = 119 bits (287), Expect = 1e-27 Identities = 49/83 (59%), Positives = 67/83 (80%) Frame = +3 Query: 108 ERYNIHSQLEHLQSKYIGTGHADTTKYEWLMNQHRDSCCSYMGHPDLLSYFAIVENESKA 287 +R+NI+SQLEHLQ+KY+GTGHAD +++EW +N RDS SY+GH +LSYFAI ENES Sbjct: 5 DRFNINSQLEHLQAKYVGTGHADLSRFEWTVNIQRDSYASYIGHYPMLSYFAIAENESIG 64 Query: 288 RVKFNLMERMLQPCGPPPEKPED 356 R ++N M++ML PCG PPE+ ++ Sbjct: 65 RERYNFMQKMLLPCGLPPEREDE 87 >At1g70560.1 68414.m08123 alliinase C-terminal domain-containing protein contains Pfam profiles: PF04864 allinase C-terminal domain, PF04863 alliinase EGF-like domain Length = 391 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 156 IGTGHADTTKYEWLMNQHRDSCCSYMGHPDLLSYFAIVEN 275 + H D T YE + D C + DL+SYF+ + N Sbjct: 25 VNLDHGDPTAYEEYWRKMGDRCTVTIRGCDLMSYFSDMTN 64 >At3g53360.1 68416.m05889 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 768 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/51 (25%), Positives = 22/51 (43%) Frame = +3 Query: 177 TTKYEWLMNQHRDSCCSYMGHPDLLSYFAIVENESKARVKFNLMERMLQPC 329 T K E LMN H +S C + + L F + S +++ ++ C Sbjct: 27 TIKTEELMNDHINSLCKSNFYREALEAFDFAQKNSSFKIRLRTYISLICAC 77 >At3g48200.1 68416.m05259 expressed protein Length = 1088 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 273 FLRSQSNSTNPDDPCSCSKS 214 F R +SNS P DP SCSKS Sbjct: 1029 FTRDRSNSKVPSDP-SCSKS 1047 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,299,987 Number of Sequences: 28952 Number of extensions: 168076 Number of successful extensions: 345 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -