SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30536
         (516 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5 prot...    23   2.1  
AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax pr...    21   6.5  
AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax pr...    21   6.5  
AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax pr...    21   6.5  
AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle nu...    21   6.5  
AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax pr...    21   6.5  
AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax pr...    21   6.5  
AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.           21   6.5  
AF261823-1|AAG13010.1|  157|Tribolium castaneum cephalothorax pr...    21   6.5  
AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduce...    21   6.5  

>AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5
           protein.
          Length = 533

 Score = 22.6 bits (46), Expect = 2.1
 Identities = 13/41 (31%), Positives = 17/41 (41%), Gaps = 1/41 (2%)
 Frame = +1

Query: 16  PESTPXKPAA-AGDSSTDSPPLANTPSKEEAPVVPAAKSAE 135
           P  T  KP     + ST +     T S  EAP  PA  + +
Sbjct: 426 PVQTTPKPGQWVPEKSTSTTQRTTTVSTTEAPPAPAVSNPQ 466


>AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 338 PSTSPRYPCHP 370
           P  +P+YP HP
Sbjct: 46  PQVAPQYPQHP 56


>AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 338 PSTSPRYPCHP 370
           P  +P+YP HP
Sbjct: 46  PQVAPQYPQHP 56


>AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax
           protein.
          Length = 230

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 338 PSTSPRYPCHP 370
           P  +P+YP HP
Sbjct: 46  PQVAPQYPQHP 56


>AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle
           nuclear receptor protein.
          Length = 407

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 10/19 (52%), Positives = 11/19 (57%)
 Frame = +2

Query: 341 STSPRYPCHPSERSRSLIS 397
           STSP  P HP   S+ L S
Sbjct: 69  STSPYPPNHPLSGSKHLCS 87


>AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 338 PSTSPRYPCHP 370
           P  +P+YP HP
Sbjct: 46  PQVAPQYPQHP 56


>AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax
           protein.
          Length = 297

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 338 PSTSPRYPCHP 370
           P  +P+YP HP
Sbjct: 46  PQVAPQYPQHP 56


>AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.
          Length = 312

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 338 PSTSPRYPCHP 370
           P  +P+YP HP
Sbjct: 46  PQVAPQYPQHP 56


>AF261823-1|AAG13010.1|  157|Tribolium castaneum cephalothorax
           protein.
          Length = 157

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 338 PSTSPRYPCHP 370
           P  +P+YP HP
Sbjct: 46  PQVAPQYPQHP 56


>AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduced
           Scr protein.
          Length = 312

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 338 PSTSPRYPCHP 370
           P  +P+YP HP
Sbjct: 46  PQVAPQYPQHP 56


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.304    0.122    0.337 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 64,920
Number of Sequences: 336
Number of extensions: 905
Number of successful extensions: 10
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12363686
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.0 bits)

- SilkBase 1999-2023 -