BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30536 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 2.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 6.5 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 6.5 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 6.5 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 6.5 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 6.5 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 6.5 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 6.5 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 6.5 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 6.5 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.6 bits (46), Expect = 2.1 Identities = 13/41 (31%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 16 PESTPXKPAA-AGDSSTDSPPLANTPSKEEAPVVPAAKSAE 135 P T KP + ST + T S EAP PA + + Sbjct: 426 PVQTTPKPGQWVPEKSTSTTQRTTTVSTTEAPPAPAVSNPQ 466 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 338 PSTSPRYPCHP 370 P +P+YP HP Sbjct: 46 PQVAPQYPQHP 56 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 338 PSTSPRYPCHP 370 P +P+YP HP Sbjct: 46 PQVAPQYPQHP 56 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 338 PSTSPRYPCHP 370 P +P+YP HP Sbjct: 46 PQVAPQYPQHP 56 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.0 bits (42), Expect = 6.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 341 STSPRYPCHPSERSRSLIS 397 STSP P HP S+ L S Sbjct: 69 STSPYPPNHPLSGSKHLCS 87 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 338 PSTSPRYPCHP 370 P +P+YP HP Sbjct: 46 PQVAPQYPQHP 56 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 338 PSTSPRYPCHP 370 P +P+YP HP Sbjct: 46 PQVAPQYPQHP 56 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 338 PSTSPRYPCHP 370 P +P+YP HP Sbjct: 46 PQVAPQYPQHP 56 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 338 PSTSPRYPCHP 370 P +P+YP HP Sbjct: 46 PQVAPQYPQHP 56 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 338 PSTSPRYPCHP 370 P +P+YP HP Sbjct: 46 PQVAPQYPQHP 56 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.304 0.122 0.337 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,920 Number of Sequences: 336 Number of extensions: 905 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.0 bits)
- SilkBase 1999-2023 -