BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30534 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 130 5e-31 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 126 9e-30 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 83 1e-16 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 48 4e-06 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 46 2e-05 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 43 1e-04 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 43 1e-04 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 42 2e-04 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 42 2e-04 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 42 2e-04 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 41 6e-04 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 41 6e-04 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 41 6e-04 At2g47490.1 68415.m05928 mitochondrial substrate carrier family ... 39 0.002 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 39 0.002 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 38 0.003 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 38 0.003 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 38 0.005 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 37 0.007 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 37 0.009 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 37 0.009 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 36 0.012 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 36 0.016 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 35 0.028 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 35 0.028 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 34 0.049 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 34 0.049 At1g07030.1 68414.m00749 mitochondrial substrate carrier family ... 34 0.065 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 33 0.086 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 33 0.11 At4g03115.1 68417.m00424 mitochondrial substrate carrier family ... 33 0.11 At5g15640.1 68418.m01830 mitochondrial substrate carrier family ... 33 0.15 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 33 0.15 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 31 0.35 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 31 0.35 At2g35800.1 68415.m04396 mitochondrial substrate carrier family ... 31 0.35 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 31 0.61 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 31 0.61 At2g26360.1 68415.m03164 mitochondrial substrate carrier family ... 30 1.1 At1g72820.1 68414.m08419 mitochondrial substrate carrier family ... 30 1.1 At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containi... 29 1.4 At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 29 1.4 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 29 1.4 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 29 2.5 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 28 3.2 At2g34710.1 68415.m04263 homeobox-leucine zipper transcription f... 28 3.2 At1g52620.1 68414.m05941 pentatricopeptide (PPR) repeat-containi... 28 3.2 At5g23940.1 68418.m02811 transferase family protein similar to a... 28 4.3 At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transfera... 27 5.7 At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 27 5.7 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 27 5.7 At4g15010.3 68417.m02307 mitochondrial substrate carrier family ... 27 7.5 At4g15010.2 68417.m02306 mitochondrial substrate carrier family ... 27 7.5 At4g15010.1 68417.m02305 mitochondrial substrate carrier family ... 27 7.5 At2g40070.1 68415.m04923 expressed protein 27 7.5 At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revo... 27 9.9 At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (D... 27 9.9 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 130 bits (314), Expect = 5e-31 Identities = 62/161 (38%), Positives = 89/161 (55%) Frame = +2 Query: 32 MFSSLLDAARNSPFRGPLSPAQCQSTVAPVAIEQTGGMAASAAVPTESCEFGSPKYFAXX 211 + +L++ N+ F SPA S + I + + AS P + E SP ++A Sbjct: 24 LLDQVLNSNSNAAFEKSPSPAPRSSPTS--MISRKNFLIASPTEPGKGIEMYSPAFYAAC 81 Query: 212 XXXXXXXXXXTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 391 TH V PLDLVKC +Q+D KYK++ +GF + ++E+GV+G +GW PT + Sbjct: 82 TFGGILSCGLTHMTVTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGVKGFFRGWVPTLL 141 Query: 392 GYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRTFVYLAAS 514 GYS QG CKFGFYE FK Y+ + E Y+T +YLA S Sbjct: 142 GYSAQGACKFGFYEYFKKTYSDLAGPEYTAKYKTLIYLAGS 182 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 126 bits (304), Expect = 9e-30 Identities = 53/127 (41%), Positives = 78/127 (61%) Frame = +2 Query: 134 TGGMAASAAVPTESCEFGSPKYFAXXXXXXXXXXXXTHTAVVPLDLVKCRLQVDAEKYKN 313 + G + + A P E E SP YFA THTA+ PLD++KC +Q+D KYKN Sbjct: 45 SNGTSFAIATPNEKVEMYSPAYFAACTVAGMLSCGITHTAITPLDVIKCNMQIDPLKYKN 104 Query: 314 VVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRT 493 + + FK +++E+G++G +GW+PT +GYS QG K+G YE K Y+ ++ E A Y+T Sbjct: 105 ITSAFKTTIKEQGLKGFTRGWSPTLLGYSAQGAFKYGLYEYAKKYYSDIVGPEYAAKYKT 164 Query: 494 FVYLAAS 514 +YLA S Sbjct: 165 LIYLAGS 171 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 82.6 bits (195), Expect = 1e-16 Identities = 39/112 (34%), Positives = 60/112 (53%) Frame = +2 Query: 179 EFGSPKYFAXXXXXXXXXXXXTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVR 358 E SP ++ TH A+ PLD++K +QV+ KY ++ +GF +RE G Sbjct: 11 ELSSPWFYTVCTMGGMLSAGTTHLAITPLDVLKVNMQVNPVKYNSIPSGFSTLLREHGHS 70 Query: 359 GLAKGWAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRTFVYLAAS 514 L +GW+ +GY +QG C+FG YE FK Y+ +L + RT +Y +S Sbjct: 71 YLWRGWSGKLLGYGVQGGCRFGLYEYFKTLYSDVLPNHN----RTSIYFLSS 118 Score = 30.7 bits (66), Expect = 0.61 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 251 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 382 A+ P + +K R+Q K +++GF R EG+ G +G P Sbjct: 128 ALCPFEAIKVRVQTQPMFAKGLLDGFPRVYRSEGLAGFHRGLFP 171 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 48.0 bits (109), Expect = 4e-06 Identities = 26/67 (38%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 421 +A PLDLV+ RL Y+ V + F+ REEG+ GL KG T +G F Sbjct: 192 SATYPLDLVRTRLSAQRNSIYYQGVGHAFRTICREEGILGLYKGLGATLLGVGPSLAISF 251 Query: 422 GFYEVFK 442 YE FK Sbjct: 252 AAYETFK 258 Score = 32.3 bits (70), Expect = 0.20 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 6/53 (11%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 388 TA PLDLV+ R+Q++ A Y + G FK + EG+RGL +G P + Sbjct: 287 TATFPLDLVRRRMQLEGAGGRARVYTTGLFGTFKHIFKTEGMRGLYRGIIPEY 339 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 46.0 bits (104), Expect = 2e-05 Identities = 24/71 (33%), Positives = 34/71 (47%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 439 PL+LVK RL + YK + + F +REEG L +G AP+ IG + Y+ Sbjct: 224 PLELVKTRLTIQRGVYKGIFDAFLKIIREEGPTELYRGLAPSLIGVVPYAATNYFAYDSL 283 Query: 440 KVAYAGMLDDE 472 + AY E Sbjct: 284 RKAYRSFSKQE 294 Score = 31.5 bits (68), Expect = 0.35 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 4/69 (5%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVDAEK----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 415 TA PL++ + +QV A YKN+++ + EG+ G KG P+ + Sbjct: 314 TATFPLEVARKHMQVGAVSGRVVYKNMLHALVTILEHEGILGWYKGLGPSCLKLVPAAGI 373 Query: 416 KFGFYEVFK 442 F YE K Sbjct: 374 SFMCYEACK 382 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 43.2 bits (97), Expect = 1e-04 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVDAE----KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 415 +A P+D+V+ RL V +Y+ + + +REEG R L +GW P+ IG Sbjct: 157 SATYPMDMVRGRLTVQTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGL 216 Query: 416 KFGFYEVFK 442 F YE K Sbjct: 217 NFSVYESLK 225 Score = 37.5 bits (83), Expect = 0.005 Identities = 26/67 (38%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Frame = +2 Query: 242 THTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 412 + TAV PL+ +K LQV KY V G K R EG+RGL KG Sbjct: 52 SRTAVAPLERMKILLQVQNPHNIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVPNSA 111 Query: 413 CKFGFYE 433 KF YE Sbjct: 112 VKFFSYE 118 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 43.2 bits (97), Expect = 1e-04 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 5/76 (6%) Frame = +2 Query: 260 PLDLVKCRLQ-----VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFG 424 P D VK +LQ V +YKN ++ ++ EGV+GL +G +F+G + + FG Sbjct: 34 PFDTVKVKLQKHNTDVQGLRYKNGLHCASRILQTEGVKGLYRGATSSFMGMAFESSLMFG 93 Query: 425 FYEVFKVAYAGMLDDE 472 Y K+ G L D+ Sbjct: 94 IYSQAKLFLRGTLPDD 109 Score = 30.7 bits (66), Expect = 0.61 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 8/78 (10%) Frame = +2 Query: 260 PLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 415 P +LVKCR+Q+ +Y + ++ +V+ +GV G+ +G + T + Sbjct: 133 PTELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIFRGGSATLLRECTGNAV 192 Query: 416 KFGFYEVFKVAYAGMLDD 469 F YE + L+D Sbjct: 193 FFTVYEYLRYHIHSRLED 210 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 41.9 bits (94), Expect = 2e-04 Identities = 30/83 (36%), Positives = 40/83 (48%), Gaps = 6/83 (7%) Frame = +2 Query: 242 THTAVVPLDLVKCRLQVDAEK------YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 403 T A+ LD+V+ R QV+ + YKN + R EG+RGL G+ P IG ++ Sbjct: 20 TVAAMHSLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIGSTV 79 Query: 404 QGLCKFGFYEVFKVAYAGMLDDE 472 F FY K YA DDE Sbjct: 80 SWGLYFFFYGRAKQRYARGRDDE 102 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 41.9 bits (94), Expect = 2e-04 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 439 PL+++K RL V E Y ++ R +G+RG G PT +G C + Y+ Sbjct: 179 PLEVLKDRLTVSPEIYPSLSLAIPRIFRADGIRGFYAGLGPTLVGMLPYSTCYYFMYDKM 238 Query: 440 KVAY 451 K +Y Sbjct: 239 KTSY 242 Score = 33.5 bits (73), Expect = 0.086 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVDAEKYK---NVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 418 T PL++ + RL V A K + N+ V++EGV GL +GW + + Sbjct: 269 TISFPLEVARKRLMVGALKGECPPNMAAAIAEVVKKEGVMGLYRGWGASCLKVMPSSGIT 328 Query: 419 FGFYEVFK 442 + FYE +K Sbjct: 329 WVFYEAWK 336 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 41.9 bits (94), Expect = 2e-04 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 2/69 (2%) Frame = +2 Query: 242 THTAVVPLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 415 T PLD++K RL V +YK V + K +REEG L KG P + + G Sbjct: 246 TGVLTTPLDVIKTRLMVQGSGTQYKGVSDCIKTIIREEGSSALWKGMGPRVLWIGIGGSI 305 Query: 416 KFGFYEVFK 442 FG E K Sbjct: 306 FFGVLEKTK 314 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 40.7 bits (91), Expect = 6e-04 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Frame = +2 Query: 260 PLDLVKCRLQVD-AEKYKNVVN-GFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 433 P+D++K RLQ+D YK + + G KV VR EGVR L KG P +++ + G Sbjct: 33 PIDVIKTRLQLDRVGAYKGIAHCGSKV-VRTEGVRALWKGLTPFATHLTLKYTLRMGSNA 91 Query: 434 VFKVAY 451 +F+ A+ Sbjct: 92 MFQTAF 97 Score = 32.7 bits (71), Expect = 0.15 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = +2 Query: 254 VVPLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 385 V P ++VK RLQ + KYK ++ + VREE + GL G APT Sbjct: 126 VTPFEVVKIRLQQQKGLSPELFKYKGPIHCARTIVREESILGLWSGAAPT 175 Score = 27.5 bits (58), Expect = 5.7 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = +2 Query: 260 PLDLVKCRLQV---DAE---KYKNVVNGFKVSVREEGVRGLAKGWAP 382 P D+VK RL D+E +YK +V+ + EEG+ L +G P Sbjct: 230 PFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLP 276 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 40.7 bits (91), Expect = 6e-04 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 9/70 (12%) Frame = +2 Query: 260 PLDLVKCRL----QVDA---EK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 412 PLDLV+ +L QV A E+ Y+ +V+ F + RE G RGL +G AP+ G Sbjct: 133 PLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFPYAG 192 Query: 413 CKFGFYEVFK 442 KF FYE K Sbjct: 193 LKFYFYEEMK 202 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 40.7 bits (91), Expect = 6e-04 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 6/67 (8%) Frame = +2 Query: 260 PLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 421 PLD+VK +LQ D K ++ + F+ V+++G RGLA+GW P + ++ + Sbjct: 252 PLDVVKTQLQCQGVCGCDRFKSSSISDVFRTIVKKDGYRGLARGWLPRMLFHAPAAAICW 311 Query: 422 GFYEVFK 442 YE K Sbjct: 312 STYETVK 318 Score = 33.9 bits (74), Expect = 0.065 Identities = 25/95 (26%), Positives = 35/95 (36%) Frame = +2 Query: 185 GSPKYFAXXXXXXXXXXXXTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGL 364 G+P A + P+D+VK RLQ+ YK V + K REEG Sbjct: 127 GNPNNSAAHAISGVFATISSDAVFTPMDMVKQRLQIGNGTYKGVWDCIKRVTREEGFGAF 186 Query: 365 AKGWAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDD 469 + T + + F YE K ML + Sbjct: 187 YASYRTTVLMNAPFTAVHFTTYEAVKRGLREMLPE 221 Score = 28.3 bits (60), Expect = 3.2 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 3/74 (4%) Frame = +2 Query: 245 HTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 415 H A+ P+D VK +Q K + F+ ++ +G L +G +G Sbjct: 53 HMAMFPVDTVKTHMQALRSCPIKPIGIRQAFRSIIKTDGPSALYRGIWAMGLGAGPAHAV 112 Query: 416 KFGFYEVFKVAYAG 457 F FYEV K +G Sbjct: 113 YFSFYEVSKKFLSG 126 >At2g47490.1 68415.m05928 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 312 Score = 38.7 bits (86), Expect = 0.002 Identities = 27/76 (35%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 242 THTAVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 406 T A PL +VK RLQ + YK+ + + EEG+RGL G P G S Sbjct: 127 TTIATNPLWVVKTRLQTQGMRVGIVPYKSTFSALRRIAYEEGIRGLYSGLVPALAGISHV 186 Query: 407 GLCKFGFYEVFKVAYA 454 + +F YE+ KV A Sbjct: 187 AI-QFPTYEMIKVYLA 201 Score = 34.3 bits (75), Expect = 0.049 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 8/73 (10%) Frame = +2 Query: 248 TAVVPLDLVKCRLQV-------DAE-KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 403 T V PLD++K R QV DA K +V + + EG+RGL +G +PT + Sbjct: 29 TFVCPLDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKREGMRGLYRGLSPTVMALLS 88 Query: 404 QGLCKFGFYEVFK 442 F Y+ K Sbjct: 89 NWAIYFTMYDQLK 101 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 38.7 bits (86), Expect = 0.002 Identities = 29/78 (37%), Positives = 37/78 (47%), Gaps = 5/78 (6%) Frame = +2 Query: 242 THTAVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 406 T A PL +VK RL + YK+V++ F EEGVRGL G P+ G S Sbjct: 131 TSIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHV 190 Query: 407 GLCKFGFYEVFKVAYAGM 460 + +F YE K A M Sbjct: 191 AI-QFPAYEKIKQYMAKM 207 Score = 37.1 bits (82), Expect = 0.007 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 8/73 (10%) Frame = +2 Query: 248 TAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 403 T V PLD++K RLQV ++ ++ K ++EEG RG+ +G +PT I Sbjct: 33 TFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLP 92 Query: 404 QGLCKFGFYEVFK 442 F Y K Sbjct: 93 NWAVYFSVYGKLK 105 Score = 28.7 bits (61), Expect = 2.5 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 6/78 (7%) Frame = +2 Query: 260 PLDLVKCRLQVDAE------KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 421 P ++++ +LQ + KY V++ R EG+ GL +G A + + + F Sbjct: 237 PHEVIRAKLQEQGQIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITF 296 Query: 422 GFYEVFKVAYAGMLDDET 475 YE+ + ++ ET Sbjct: 297 TTYEMMLRFFRQVVPPET 314 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 439 PLD ++ ++Q+ YK+V++ F + EGV GL +G+ P + K +++ Sbjct: 325 PLDTIRRQMQLKGTPYKSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLTTFDIV 384 Query: 440 K 442 K Sbjct: 385 K 385 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +2 Query: 287 QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKVAYAG 457 Q A+K + + +EEG++G KG P I + YE +K + G Sbjct: 152 QQSAKKAIGFIEAITLIGKEEGIKGYWKGNLPQVIRIVPYSAVQLFAYETYKKLFRG 208 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 38.3 bits (85), Expect = 0.003 Identities = 26/76 (34%), Positives = 33/76 (43%), Gaps = 9/76 (11%) Frame = +2 Query: 257 VPLDLVKCRLQ---------VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 409 +PLD K RLQ V KY+ ++ REEG+R L KG P + G Sbjct: 30 IPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQCLFG 89 Query: 410 LCKFGFYEVFKVAYAG 457 + G YE K Y G Sbjct: 90 GLRIGMYEPVKNLYVG 105 Score = 35.9 bits (79), Expect = 0.016 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 7/68 (10%) Frame = +2 Query: 260 PLDLVKCRLQVDAE-------KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 418 P DLVK RLQ + + +Y +N + VR+EGVR L G P ++ + Sbjct: 134 PTDLVKVRLQAEGKLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAE 193 Query: 419 FGFYEVFK 442 Y+ K Sbjct: 194 LASYDQVK 201 Score = 35.1 bits (77), Expect = 0.028 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 388 P+D+VK R+ D+ YK ++ F +++ +G KG+ P F Sbjct: 234 PVDVVKSRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNF 276 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 37.5 bits (83), Expect = 0.005 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +2 Query: 254 VVPLDLVKCRLQVDAEK---YKNVVNGFKVSVREEGVRGLAKGWAP 382 V P D+VK LQVD K Y ++ F+ ++ EGV+GL KG+ P Sbjct: 231 VYPTDVVKSVLQVDDYKNPRYTGSMDAFRKILKSEGVKGLYKGFGP 276 Score = 33.9 bits (74), Expect = 0.065 Identities = 30/84 (35%), Positives = 36/84 (42%), Gaps = 15/84 (17%) Frame = +2 Query: 260 PLDLVKCRLQ--------------VDAEKYKNVVNGFKVSVREEG-VRGLAKGWAPTFIG 394 P +L+KCRLQ V A KY ++ + +R EG RGL KG PTF Sbjct: 124 PTELIKCRLQAQGALAGASTTSSVVAAVKYGGPMDVARHVLRSEGGARGLFKGLFPTFAR 183 Query: 395 YSMQGLCKFGFYEVFKVAYAGMLD 466 F YE FK AG D Sbjct: 184 EVPGNATMFAAYEAFKRFLAGGSD 207 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 37.1 bits (82), Expect = 0.007 Identities = 22/79 (27%), Positives = 38/79 (48%) Frame = +2 Query: 242 THTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 421 + TA PLD +K LQ+ + + K+ ++ GVRG +G + + + KF Sbjct: 222 SRTATAPLDRLKVLLQIQKTDAR-IREAIKLIWKQGGVRGFFRGNGLNIVKVAPESAIKF 280 Query: 422 GFYEVFKVAYAGMLDDETA 478 YE+FK A + ++ A Sbjct: 281 YAYELFKNAIGENMGEDKA 299 Score = 36.7 bits (81), Expect = 0.009 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVDAEKYKNVVNG-FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFG 424 T V PL +V+ R+Q AE+ + ++G F+ ++ EEG R L KG P + + Sbjct: 418 TCVYPLQVVRTRMQ--AERARTSMSGVFRRTISEEGYRALYKGLLPNLLKVVPAASITYM 475 Query: 425 FYEVFK 442 YE K Sbjct: 476 VYEAMK 481 Score = 27.5 bits (58), Expect = 5.7 Identities = 20/68 (29%), Positives = 27/68 (39%), Gaps = 4/68 (5%) Frame = +2 Query: 251 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVRE----EGVRGLAKGWAPTFIGYSMQGLCK 418 ++ PLDLVK RLQ + V ++ EG R KG P+ +G Sbjct: 320 SIYPLDLVKTRLQTYTSQAGVAVPRLGTLTKDILVHEGPRAFYKGLFPSLLGIIPYAGID 379 Query: 419 FGFYEVFK 442 YE K Sbjct: 380 LAAYETLK 387 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 36.7 bits (81), Expect = 0.009 Identities = 23/103 (22%), Positives = 48/103 (46%), Gaps = 9/103 (8%) Frame = +2 Query: 185 GSPKYFAXXXXXXXXXXXXTHTAVVPLDLVKCRLQVDAEK--------YKNVVNGFKVSV 340 G K+FA T + LD + RL DA++ +K +++ ++ ++ Sbjct: 110 GYLKWFAGNVASGSAAGATTSLFLYHLDYARTRLGTDAKECSVNGKRQFKGMIDVYRKTL 169 Query: 341 REEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK-VAYAGMLD 466 +G++GL +G+ + +G ++ FG Y+ K + G L+ Sbjct: 170 SSDGIKGLYRGFGVSIVGITLYRGMYFGMYDTIKPIVLVGSLE 212 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 36.7 bits (81), Expect = 0.009 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +2 Query: 260 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 433 P DL++ L Q + + Y N+ + F V+ G++GL G +PT I +FG Y+ Sbjct: 146 PFDLLRTVLASQGEPKVYPNMRSAFLSIVQTRGIKGLYAGLSPTLIEIIPYAGLQFGTYD 205 Query: 434 VFK 442 FK Sbjct: 206 TFK 208 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 36.3 bits (80), Expect = 0.012 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +2 Query: 257 VPLDLVKCRLQV-DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 433 +PLD ++ +L E + F+ ++ EG+ L KG P+ ++ G +G Y+ Sbjct: 160 LPLDTIRTKLVARGGEALGGIGGAFRYMIQTEGLFSLYKGLVPSIASMALSGAVFYGVYD 219 Query: 434 VFKVAY 451 + K ++ Sbjct: 220 ILKSSF 225 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 35.9 bits (79), Expect = 0.016 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 388 P+D+VK R+ D+ Y+N V+ F +++ EG+ KG+ P F Sbjct: 236 PIDVVKSRMMGDST-YRNTVDCFIKTMKTEGIMAFYKGFLPNF 277 Score = 34.3 bits (75), Expect = 0.049 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +2 Query: 257 VPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 406 +PLD K RLQ+ D E KY+ + REEG+ GL KG + Sbjct: 31 IPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIY 90 Query: 407 GLCKFGFYEVFKVAYAG 457 G + G YE K G Sbjct: 91 GGLRIGLYEPVKTLLVG 107 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 35.1 bits (77), Expect = 0.028 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +2 Query: 260 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 433 P DL++ L Q + + Y + + F ++ G+RGL G PT + +FG Y+ Sbjct: 151 PFDLLRTILASQGEPKVYPTMRSAFVDIIQSRGIRGLYNGLTPTLVEIVPYAGLQFGTYD 210 Query: 434 VFK 442 +FK Sbjct: 211 MFK 213 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 296 AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 391 A KY +V K REEG RG +G P + Sbjct: 66 ASKYTGMVQATKDIFREEGFRGFWRGNVPALL 97 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 35.1 bits (77), Expect = 0.028 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +2 Query: 251 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 430 A PLD+VK RLQ Y+ + + F+ SV++EG L +G + F Y Sbjct: 217 ACYPLDVVKTRLQQGHGAYEGIADCFRKSVKQEGYTVLWRGLGTAVARAFVVNGAIFAAY 276 Query: 431 EV 436 EV Sbjct: 277 EV 278 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 34.3 bits (75), Expect = 0.049 Identities = 18/65 (27%), Positives = 32/65 (49%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 427 + V PL +++ R+Q D+ K ++ F ++R EG++G +G P F + Sbjct: 409 SCVYPLQVIRTRMQADSSK-TSMGQEFLKTLRGEGLKGFYRGIFPNFFKVIPSASISYLV 467 Query: 428 YEVFK 442 YE K Sbjct: 468 YEAMK 472 Score = 31.1 bits (67), Expect = 0.46 Identities = 22/72 (30%), Positives = 30/72 (41%) Frame = +2 Query: 242 THTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 421 + TA PLD +K LQV VV K RE+ + G +G + + KF Sbjct: 218 SRTATAPLDRLKVALQVQRTNL-GVVPTIKKIWREDKLLGFFRGNGLNVAKVAPESAIKF 276 Query: 422 GFYEVFKVAYAG 457 YE+ K G Sbjct: 277 AAYEMLKPIIGG 288 Score = 29.1 bits (62), Expect = 1.9 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = +2 Query: 248 TAVVPLDLVKCRLQ--VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 421 TA+ P+DLVK RLQ V + K +EG R +G P+ IG Sbjct: 311 TAIYPMDLVKTRLQTFVSEVGTPKLWKLTKDIWIQEGPRAFYRGLCPSLIGIIPYAGIDL 370 Query: 422 GFYEVFK 442 YE K Sbjct: 371 AAYETLK 377 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 34.3 bits (75), Expect = 0.049 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +2 Query: 257 VPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 406 +PLD K RLQ+ D E KY+ + REEG+ GL KG + Sbjct: 31 IPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIY 90 Query: 407 GLCKFGFYEVFKVAYAG 457 G + G YE K G Sbjct: 91 GGLRIGLYEPVKTLLVG 107 >At1g07030.1 68414.m00749 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 326 Score = 33.9 bits (74), Expect = 0.065 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 439 P+D+VK RLQ+ YK V + K +REEG+ + T + + F YE Sbjct: 150 PMDMVKQRLQMGEGTYKGVWDCVKRVLREEGIGAFYASYRTTVLMNAPFTAVHFATYEAA 209 Query: 440 K 442 K Sbjct: 210 K 210 Score = 33.5 bits (73), Expect = 0.086 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 7/80 (8%) Frame = +2 Query: 260 PLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 421 PLD+VK +LQ D ++ + + V+++G RGL +GW P + ++ + Sbjct: 247 PLDVVKTQLQCQGVCGCDRFTSSSISHVLRTIVKKDGYRGLLRGWLPRMLFHAPAAAICW 306 Query: 422 GFYEVFKVAYAGM-LDDETA 478 YE K + +D TA Sbjct: 307 STYEGVKSFFQDFNVDSNTA 326 Score = 28.7 bits (61), Expect = 2.5 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 3/69 (4%) Frame = +2 Query: 245 HTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 415 H A+ P+D +K +Q K + F+ +++EG L +G +G Sbjct: 51 HMAMFPVDTIKTHMQALRPCPLKPVGIREAFRSIIQKEGPSALYRGIWAMGLGAGPAHAV 110 Query: 416 KFGFYEVFK 442 F FYEV K Sbjct: 111 YFSFYEVSK 119 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 33.5 bits (73), Expect = 0.086 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +2 Query: 260 PLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 397 PLD+VK RLQV KYK ++ R+EG +G +G P + Y Sbjct: 271 PLDVVKTRLQVQGSTIKYKGWLDAVGQIWRKEGPQGFFRGSVPRVMWY 318 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 33.1 bits (72), Expect = 0.11 Identities = 18/65 (27%), Positives = 31/65 (47%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 427 + V PL +V+ R+Q D+ K + F +++ EG+RG +G P + + Sbjct: 410 SCVYPLQVVRTRMQADSSK-TTMKQEFMNTMKGEGLRGFYRGLLPNLLKVVPAASITYIV 468 Query: 428 YEVFK 442 YE K Sbjct: 469 YEAMK 473 Score = 30.7 bits (66), Expect = 0.61 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 3/68 (4%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVR---EEGVRGLAKGWAPTFIGYSMQGLCK 418 TA+ P+DLVK RLQ + +K++ EG R KG P+ +G Sbjct: 312 TAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLLGIVPYAGID 371 Query: 419 FGFYEVFK 442 YE K Sbjct: 372 LAAYETLK 379 >At4g03115.1 68417.m00424 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 341 Score = 33.1 bits (72), Expect = 0.11 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNG----FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 427 PLD+VK RLQ+ + + G F ++ EG R L G P + G + G Sbjct: 83 PLDVVKVRLQMQHVGQRGPLIGMTGIFLQLMKNEGRRSLYLGLTPALTRSVLYGGLRLGL 142 Query: 428 YEVFKVAY 451 YE KV++ Sbjct: 143 YEPTKVSF 150 >At5g15640.1 68418.m01830 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 323 Score = 32.7 bits (71), Expect = 0.15 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%) Frame = +2 Query: 260 PLDLVKCRLQV--DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 433 PLD +K RLQV E + K + E+G +G +G P F S G YE Sbjct: 254 PLDTIKTRLQVMGHQENRPSAKQVVKKLLAEDGWKGFYRGLGPRFFSMSAWGTSMILTYE 313 Query: 434 VFK 442 K Sbjct: 314 YLK 316 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 32.7 bits (71), Expect = 0.15 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +2 Query: 260 PLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 433 P D+VK R+ E Y+N + +V+ EG+R L KG+ PT+ + YE Sbjct: 235 PADVVKTRMMNQGENAVYRNSYDCLVKTVKFEGIRALWKGFFPTWARLGPWQFVFWVSYE 294 Query: 434 VFKV 445 F++ Sbjct: 295 KFRL 298 Score = 31.5 bits (68), Expect = 0.35 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 8/49 (16%) Frame = +2 Query: 260 PLDLVKCRLQVDAE--------KYKNVVNGFKVSVREEGVRGLAKGWAP 382 P DLVK R+Q D +Y + F ++ EGV+GL KG P Sbjct: 134 PADLVKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLP 182 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 31.5 bits (68), Expect = 0.35 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 382 PLD V+ ++Q+ YK++ F + +G+ GL +G+ P Sbjct: 297 PLDTVRRQMQMRGTPYKSIPEAFAGIIDRDGLIGLYRGFLP 337 Score = 29.1 bits (62), Expect = 1.9 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 8/83 (9%) Frame = +2 Query: 248 TAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 403 T PLD +K +Q A+K + + +EEGV+G KG P I Sbjct: 103 TVTAPLDRIKLLMQTHGIRLGQQSAKKAIGFIEAITLIAKEEGVKGYWKGNLPQVIRVLP 162 Query: 404 QGLCKFGFYEVFKVAYAGMLDDE 472 + YE +K + G DD+ Sbjct: 163 YSAVQLLAYESYKNLFKGK-DDQ 184 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 31.5 bits (68), Expect = 0.35 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 6/53 (11%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 388 TA PLDLV+ R+QV+ A Y + G FK + EG +G+ +G P + Sbjct: 259 TATYPLDLVRRRMQVEGAGGRARVYNTGLFGTFKHIFKSEGFKGIYRGILPEY 311 >At2g35800.1 68415.m04396 mitochondrial substrate carrier family protein contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 823 Score = 31.5 bits (68), Expect = 0.35 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNGFKVSV-REEGVRGLAKGWAPTFIGYSMQGLCKFGFYEV 436 P D++K R+ ++ VS+ R EG GL KG P F + G F YE+ Sbjct: 741 PFDVMKTRMMTATPGRPISMSMVVVSILRNEGPLGLFKGAVPRFFWVAPLGAMNFAGYEL 800 Query: 437 FKVA 448 K A Sbjct: 801 AKKA 804 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 30.7 bits (66), Expect = 0.61 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +2 Query: 251 AVVPLDLVKCRLQV---DAEKYKNVVNGFKVSVREEGVRGLAKG 373 A P+D V+ R+ + +A KYK+ + F V++EG + L KG Sbjct: 307 ASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKKEGAKSLFKG 350 Score = 29.9 bits (64), Expect = 1.1 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 9/74 (12%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 400 TA P++ VK +Q E YK + + F ++R+EG+ L +G I Y Sbjct: 100 TAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYF 159 Query: 401 MQGLCKFGFYEVFK 442 F F + FK Sbjct: 160 PTQALNFAFKDYFK 173 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 30.7 bits (66), Expect = 0.61 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 305 YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 442 Y + ++ +E G RGL +G PT IG KF YE K Sbjct: 171 YSGIKEVLAMAYKEGGPRGLYRGIGPTLIGILPYAGLKFYIYEELK 216 Score = 27.5 bits (58), Expect = 5.7 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 2/67 (2%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVDAEKYK--NVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 421 TAV PL+ +K LQ +K V K ++ +G G KG + I + Sbjct: 39 TAVAPLERIKILLQTRTNDFKTLGVSQSLKKVLQFDGPLGFYKGNGASVIRIIPYAALHY 98 Query: 422 GFYEVFK 442 YEV++ Sbjct: 99 MTYEVYR 105 >At2g26360.1 68415.m03164 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 303 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 391 T +P +++K RLQ A ++ N+V + +EG++GL +G T + Sbjct: 133 TLRIPCEVLKQRLQ--ANQFDNIVEATVSTWHQEGLKGLFRGTGVTLL 178 >At1g72820.1 68414.m08419 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 349 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +2 Query: 251 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIG 394 A+ P L+K R QV + + F + VR EG+RGL +G+ + +G Sbjct: 44 ALYPAVLMKTRQQVCHSQGSCIKTAFTL-VRHEGLRGLYRGFGTSLMG 90 >At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 730 Score = 29.5 bits (63), Expect = 1.4 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 7/57 (12%) Frame = +2 Query: 293 DAEKYKNVVNGF----KVSVREEGV-RGLAKGWAPTFI--GYSMQGLCKFGFYEVFK 442 DAE + +V+ G +++ + V R L +G+AP I GY M GLCK G + K Sbjct: 286 DAETFNDVILGLCKFDRINEAAKMVNRMLIRGFAPDDITYGYLMNGLCKIGRVDAAK 342 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 29.5 bits (63), Expect = 1.4 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 9/74 (12%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 400 TA P++ VK +Q +E YK + + F +V++EG+ L +G I Y Sbjct: 95 TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGMLALWRGNTANVIRYF 154 Query: 401 MQGLCKFGFYEVFK 442 F F + FK Sbjct: 155 PTQALNFAFKDYFK 168 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 338 VREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 442 +REEG+R L G + T + ++ + G Y++ K Sbjct: 72 IREEGMRALFSGVSATVLRQTLYSTTRMGLYDIIK 106 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 260 PLDLVKCRLQ-VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 385 P+D+VK R+ D E Y ++ V EEG L KG PT Sbjct: 268 PIDVVKTRMMNADKEIYGGPLDCAVKMVAEEGPMALYKGLVPT 310 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 5/72 (6%) Frame = +2 Query: 254 VVPLDLVKCRLQVD-----AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 418 V PLD+ RL D A +++ + + +++GVRG+ +G + G + Sbjct: 159 VYPLDIAHTRLAADIGKPEARQFRGIHHFLSTIHKKDGVRGIYRGLPASLHGVIIHRGLY 218 Query: 419 FGFYEVFKVAYA 454 FG ++ K ++ Sbjct: 219 FGGFDTVKEIFS 230 >At2g34710.1 68415.m04263 homeobox-leucine zipper transcription factor (HB-14) identical to homeodomain transcription factor (ATHB-14)GP:3132474 GB:Y11122 [Arabidopsis thaliana]; Length = 852 Score = 28.3 bits (60), Expect = 3.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -1 Query: 234 HDRTPPTPQRAKYLGDPNSQDSVGTAADAAMPPVCSIATGATVDW 100 H + P PQ + D N+ + + A+ A+ S ATG VDW Sbjct: 151 HQQQNPNPQHQQR--DANNPAGLLSIAEEALAEFLSKATGTAVDW 193 >At1g52620.1 68414.m05941 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 819 Score = 28.3 bits (60), Expect = 3.2 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 5/67 (7%) Frame = +2 Query: 314 VVNGFKVSVREEGVRGLAKGWAPTFIGYSM--QGLCKFGFYEVFKVAYAGMLDDE---TA 478 VV+G V+ + +G +P Y+M GLCK G + K+ ++ MLD A Sbjct: 426 VVSGHMDDAVNMKVKLIDRGVSPDAAIYNMLMSGLCKTGRFLPAKLLFSEMLDRNILPDA 485 Query: 479 YTYRTFV 499 Y Y T + Sbjct: 486 YVYATLI 492 >At5g23940.1 68418.m02811 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 484 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 339 TDTLKPFTTFLYFSASTWRRHFTRSRG 259 +D+ KPF+TF ++ W RH T +RG Sbjct: 263 SDSSKPFSTFQSLTSHIW-RHVTLARG 288 >At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 281 RLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 421 R + EK + + GF+ V+ +G+ + +GWAP + Q C F Sbjct: 325 RKNIGIEKEEWLPEGFEERVKGKGM--IIRGWAPQVLILDHQATCGF 369 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 27.5 bits (58), Expect = 5.7 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 9/74 (12%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 400 TA P++ VK +Q +E YK + + F ++++EG L +G I Y Sbjct: 96 TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYF 155 Query: 401 MQGLCKFGFYEVFK 442 F F + FK Sbjct: 156 PTQALNFAFKDYFK 169 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 27.5 bits (58), Expect = 5.7 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 9/74 (12%) Frame = +2 Query: 248 TAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 400 TA P++ VK +Q +E YK + + F ++++EG L +G I Y Sbjct: 96 TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYF 155 Query: 401 MQGLCKFGFYEVFK 442 F F + FK Sbjct: 156 PTQALNFAFKDYFK 169 >At4g15010.3 68417.m02307 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.1 bits (57), Expect = 7.5 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 2/66 (3%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 433 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 434 VFKVAY 451 + Y Sbjct: 90 ILTAFY 95 >At4g15010.2 68417.m02306 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.1 bits (57), Expect = 7.5 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 2/66 (3%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 433 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 434 VFKVAY 451 + Y Sbjct: 90 ILTAFY 95 >At4g15010.1 68417.m02305 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.1 bits (57), Expect = 7.5 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 2/66 (3%) Frame = +2 Query: 260 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 433 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 434 VFKVAY 451 + Y Sbjct: 90 ILTAFY 95 >At2g40070.1 68415.m04923 expressed protein Length = 607 Score = 27.1 bits (57), Expect = 7.5 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 8/83 (9%) Frame = -1 Query: 372 PLARPRTPSSRTDTL-------KPFT-TFLYFSASTWRRHFTRSRGTTAVWVRPHDRTPP 217 P +RP TP+ R+ TL +P T T +S R T SR T + +P + Sbjct: 182 PGSRPATPTGRSSTLTANSKSSRPSTPTSRATVSSATRPSLTNSRSTVSATTKPTPMSRS 241 Query: 216 TPQRAKYLGDPNSQDSVGTAADA 148 T + L S+ + TA A Sbjct: 242 TSLSSSRLTPTASKPTTSTARSA 264 >At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revoluta (REV) / fascicular fiberless 1 (IFL1) identical to HD-zip transcription factor Revoluta (GI:9759333) {Arabidopsis thaliana}; contains Pfam profiles PF01852: START domain and PF00046: Homeobox domain Length = 842 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 216 TPQRAKYLGDPNSQDSVGTAADAAMPPVCSIATGATVDW 100 TPQ + L D NS + + A+ + S ATG VDW Sbjct: 144 TPQHS--LRDANSPAGLLSIAEETLAEFLSKATGTAVDW 180 >At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (DTC) identical to dicarboxylate/tricarboxylate carrier [Arabidopsis thaliana] GI:19913113 Length = 298 Score = 26.6 bits (56), Expect = 9.9 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 7/51 (13%) Frame = +2 Query: 260 PLDLVKCRLQVD----AEKYKNVVNGFKVSVR---EEGVRGLAKGWAPTFI 391 P DL R+Q D + +N N F R +EGV L KG PT + Sbjct: 125 PADLALIRMQADNTLPLAQRRNYTNAFHALTRISADEGVLALWKGCGPTVV 175 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,521,383 Number of Sequences: 28952 Number of extensions: 207994 Number of successful extensions: 751 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -