BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30530 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 97 9e-23 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 10.0 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 97.1 bits (231), Expect = 9e-23 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -3 Query: 514 SGGTXMYPGIADRMQKEIXALXPSTXXXXXIAPPXRKYSVWIGGSILASLSXFQXMWIS 338 SGGT MYPGIADRMQKEI AL PST IAPP +KYSVWIGGSILASLS FQ MWIS Sbjct: 75 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTFQQMWIS 133 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 20.6 bits (41), Expect = 10.0 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = -2 Query: 419 SPRXEVLRMDRWIHPGFPV 363 +P + + + WIHP P+ Sbjct: 531 NPLTDTVPIHTWIHPWLPL 549 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,039 Number of Sequences: 438 Number of extensions: 1380 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -