BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30529 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 30 0.98 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 29 3.0 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 28 4.0 SB_20508| Best HMM Match : Filament (HMM E-Value=0.037) 28 4.0 SB_6360| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.0092) 27 9.2 SB_35052| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_14715| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.0024) 27 9.2 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 34.7 bits (76), Expect = 0.046 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +2 Query: 332 DTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGK 475 D +++ K + +LE + DL+ +KRKD+ I+DLN V D + K Sbjct: 400 DELRKTKKKMQVQYEKLEHQLDDLKVQLKRKDVVIADLNKVVEDYKRK 447 >SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 31.1 bits (67), Expect = 0.56 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +2 Query: 329 EDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQV 457 ED + R + +RI RLE DL+ + +R SD+N++V Sbjct: 22 EDLMTRRFRGLEDRIGRLESTVSDLQLLQRRNGRFFSDINTRV 64 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 30.3 bits (65), Expect = 0.98 Identities = 15/44 (34%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = +2 Query: 383 EDEKFD--LEYIVKRKDMEISDLNSQVNDLRGKFVKPTLKKVSK 508 ++EKF L ++ RKD I +LN+++ L+G + K T ++++K Sbjct: 997 QNEKFSETLNSVISRKDKAIDELNAKIRHLQGDYDK-TRRQLNK 1039 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/49 (30%), Positives = 30/49 (61%), Gaps = 3/49 (6%) Frame = +2 Query: 329 EDTIKRVCKDYHERIARLE---DEKFDLEYIVKRKDMEISDLNSQVNDL 466 ED +++V K +A L+ +EK D E +++ + +++LN+Q+ DL Sbjct: 1901 EDELEKVRKKEVSLLATLDTLREEKKDQEQMLQDNGIRLAELNTQIQDL 1949 Score = 28.3 bits (60), Expect = 4.0 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = +2 Query: 320 DANEDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLR 469 D E TIK + ++ + R +DE DL V +K+ E L++Q++DLR Sbjct: 3021 DIAESTIKNIKQEKN----RFQDEVNDLHGKVSQKNSENELLHAQLDDLR 3066 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/24 (41%), Positives = 20/24 (83%) Frame = +2 Query: 320 DANEDTIKRVCKDYHERIARLEDE 391 + +E+ +++V +DY E+IARL++E Sbjct: 144 EPDEEQLEQVRRDYEEQIARLQEE 167 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/54 (22%), Positives = 31/54 (57%) Frame = +2 Query: 323 ANEDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGKFVK 484 A+++ I+ + ++++++DE +L+ R+ EI DL +++N+L + Sbjct: 1352 ASKEYIEGQLESLKAQMSKIKDENENLKESDARRQQEILDLENRINELENMLAR 1405 >SB_20508| Best HMM Match : Filament (HMM E-Value=0.037) Length = 722 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +2 Query: 308 KNIDDANEDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDL 445 + + +NE + RV D E + L+ +K DLE I ++ + +L Sbjct: 51 EELQTSNESELMRVRSDLEEMTSLLQSKKVDLEKIKEQNEKAAKEL 96 >SB_6360| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.0092) Length = 107 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 356 DYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGK 475 D + ++ L + DL+ V D ++ DLN++V+DL K Sbjct: 26 DLNAKVHDLNTKVHDLDTKVHDLDTKVHDLNTKVHDLNTK 65 >SB_35052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = +2 Query: 332 DTIKRVCKDYHERIAR-LEDEKF---DLEYIVKRKDMEISDLNS 451 D I+R + ++R LE+ K +LE V +KDME++DLN+ Sbjct: 6 DKIRRKLESELAEVSRQLEEAKQQIQELEAAVHKKDMELNDLNA 49 >SB_14715| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.0024) Length = 2040 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 356 DYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGKFVK 484 D + ++ L + DL V + ++ DLN++VNDL K K Sbjct: 348 DLNTKVHDLNTKLHDLNTKVHDLNAKVHDLNTKVNDLNTKNTK 390 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,996,642 Number of Sequences: 59808 Number of extensions: 159326 Number of successful extensions: 488 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -