BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30528 (508 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 22 2.7 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 22 3.6 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 21 4.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.3 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 6.3 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 21 6.3 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 21 6.3 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 6.3 X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 21 8.4 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 21 8.4 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 22.2 bits (45), Expect = 2.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 293 IENGVFDVLVTGDD 334 I+NGVF+V+ T D Sbjct: 39 IDNGVFEVVATSGD 52 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.8 bits (44), Expect = 3.6 Identities = 8/27 (29%), Positives = 18/27 (66%) Frame = +2 Query: 179 RSLDAQQMQQVLDAMFEKRSEPGEYVI 259 ++ + ++QQ++D + K S+P + VI Sbjct: 113 KTSETSKLQQLVDNIEHKLSDPNQCVI 139 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.4 bits (43), Expect = 4.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 354 THTKVPVRLANWP*CTTCRGRHL 422 ++ +V V+LAN TT G+HL Sbjct: 329 SYPEVCVKLANPQKLTTAAGKHL 351 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.3 Identities = 10/16 (62%), Positives = 10/16 (62%), Gaps = 1/16 (6%) Frame = +2 Query: 47 RKSVFAET-YDPEEDD 91 R S ET YDP EDD Sbjct: 160 RHSEIVETVYDPREDD 175 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.0 bits (42), Expect = 6.3 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = -1 Query: 358 CVDHLFDAVVSGDQDVENAVLDDVE 284 C++HLF + GD ++ +++ +E Sbjct: 378 CLEHLFFFKLIGDVPIDTFLMEMLE 402 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.0 bits (42), Expect = 6.3 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = -2 Query: 363 SYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSD---LFSNIASRTCCICC 193 SY++TT+S + S + + T L+ + ++ Y +D L SN+ S Sbjct: 92 SYIYTTYSRKLSGIFKYIDQMAGYTGFLAMLTSMVMFYKRSNDLKTLLSNLES-IQIYSI 150 Query: 192 ASRERNSS 169 +ERNS+ Sbjct: 151 KPKERNSN 158 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 21.0 bits (42), Expect = 6.3 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = -2 Query: 363 SYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSD---LFSNIASRTCCICC 193 SY++TT+S + S + + T L+ + ++ Y +D L SN+ S Sbjct: 48 SYIYTTYSRKLSGIFKYIDQMAGYTGFLAMLTSMVMFYKRSNDLKTLLSNLES-IQIYSI 106 Query: 192 ASRERNSS 169 +ERNS+ Sbjct: 107 KPKERNSN 114 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -1 Query: 451 PQSAGGLGPYRCRPRH 404 P G LG Y RP H Sbjct: 65 PSPRGALGAYPFRPMH 80 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 20.6 bits (41), Expect = 8.4 Identities = 13/73 (17%), Positives = 30/73 (41%) Frame = -1 Query: 322 DQDVENAVLDDVEVVAVIALSDYVLAGLGSLFEHRIQNLLHLLRVKRTEQQYAPDRLSET 143 D + + DD + +++D G G + EHR + + +++ + Q + Sbjct: 347 DNNDQGPPQDDAGNLISPSINDDGTCGNGYVCEHRWRQIFNMVGFRNAVQGTGIENWWSD 406 Query: 142 GSLCVRLGEHGRG 104 G+ + G +G Sbjct: 407 GNQQIAFGRGNKG 419 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 20.6 bits (41), Expect = 8.4 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -1 Query: 475 GNVWRSMAPQSAGGLGP--YRCRPR 407 G++ RS +PQ++ GP RC R Sbjct: 86 GSLXRSSSPQTSAPTGPPIVRCALR 110 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,885 Number of Sequences: 336 Number of extensions: 2797 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12049355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -