BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30528 (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19865| Best HMM Match : cNMP_binding (HMM E-Value=8.3e-39) 116 8e-27 SB_58379| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 4e-24 SB_12691| Best HMM Match : cNMP_binding (HMM E-Value=1.7e-26) 73 2e-13 SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_52453| Best HMM Match : cNMP_binding (HMM E-Value=1.9e-26) 54 7e-08 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) 43 1e-04 SB_56249| Best HMM Match : cNMP_binding (HMM E-Value=5.4e-23) 42 2e-04 SB_43598| Best HMM Match : cNMP_binding (HMM E-Value=4.3e-22) 42 3e-04 SB_16296| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_33011| Best HMM Match : cNMP_binding (HMM E-Value=0.037) 40 9e-04 SB_18428| Best HMM Match : cNMP_binding (HMM E-Value=0.037) 40 9e-04 SB_29572| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_9442| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.044 SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.044 SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) 34 0.059 SB_11282| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.059 SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.077 SB_16528| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.10 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 33 0.14 SB_3342| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 33 0.18 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_33629| Best HMM Match : Extensin_2 (HMM E-Value=2.2) 32 0.24 SB_17979| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_50313| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_48433| Best HMM Match : Ion_trans (HMM E-Value=6.1e-26) 31 0.41 SB_44245| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_27819| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) 31 0.41 SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 31 0.55 SB_25036| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_21541| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_7619| Best HMM Match : ArfGap (HMM E-Value=5.3) 31 0.72 SB_26738| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_44854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_16017| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-19) 29 2.2 SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 29 2.9 SB_52670| Best HMM Match : FxsA (HMM E-Value=2.5) 29 2.9 SB_5902| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_29857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_29710| Best HMM Match : LHC (HMM E-Value=3.3) 28 3.8 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_57887| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_19362| Best HMM Match : M (HMM E-Value=0.0014) 28 3.8 SB_14508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) 28 5.1 SB_35537| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_3203| Best HMM Match : FGF (HMM E-Value=0.013) 27 6.7 SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 27 8.9 SB_18513| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_49169| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_47365| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_37674| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_36054| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_27965| Best HMM Match : Sec61_beta (HMM E-Value=0.84) 27 8.9 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_7359| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_19865| Best HMM Match : cNMP_binding (HMM E-Value=8.3e-39) Length = 373 Score = 116 bits (280), Expect = 8e-27 Identities = 60/144 (41%), Positives = 88/144 (61%), Gaps = 1/144 (0%) Frame = +2 Query: 23 PVARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQQM 202 P+ + +RR +V AE Y+P E+ +D A PKS+ QR L + + + LF + + Sbjct: 75 PIIKGRSRRAAVSAEPYNPNEN-ADFKAK-FHPKSEEQRNHLKKKLLELWLFEKFHREDL 132 Query: 203 QQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKV-VHTYEGSGSF 379 +LD+MFEK+ P E +I+ GD+GDNFYVI G +DV + + VHT+ G+G F Sbjct: 133 DVILDSMFEKKVSPEEIIIKVGDEGDNFYVINTGEYDVFALDTNTGASIKVHTFNGTGMF 192 Query: 380 GELALMYNMPRAASVRAQTAGALW 451 GELALM+N R A++ A+T G LW Sbjct: 193 GELALMHNSLRNATIVAKTEGTLW 216 Score = 60.5 bits (140), Expect = 8e-10 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 1/100 (1%) Frame = +2 Query: 134 QRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDN-FYVIENGVF 310 +R R E ++ + + + L ++ +V DA++ K + GE VIR+G++ Y IE G Sbjct: 234 RRERNIELLKSVSILKELKPDELDKVSDALYPKEFKDGEAVIREGNESAYCMYFIEKGKV 293 Query: 311 DVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPRAASVRA 430 V V D VEK V FGELAL+ N PR+ASV A Sbjct: 294 RVTVK-DGEVEKTVEF--DKNYFGELALVMNQPRSASVYA 330 >SB_58379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 107 bits (258), Expect = 4e-24 Identities = 47/94 (50%), Positives = 72/94 (76%) Frame = +2 Query: 17 KPPVARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQ 196 +PP R+ RR+SV AE + P+ +D + P V+PK+D QR RL +A++ ILLF++L + Sbjct: 92 EPPKNRYA-RRQSVCAEPFHPDSEDEGDEQPIVYPKTDEQRQRLNDAIKNILLFKNLAKE 150 Query: 197 QMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIE 298 Q+ +VLDAMFE++++ G+++I QGDDGDNFYVI+ Sbjct: 151 QLNEVLDAMFERKTQAGDHIIDQGDDGDNFYVID 184 >SB_12691| Best HMM Match : cNMP_binding (HMM E-Value=1.7e-26) Length = 376 Score = 72.5 bits (170), Expect = 2e-13 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 1/111 (0%) Frame = +2 Query: 122 KSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIEN 301 K + + + EA+ ++L+A Q+++V++ M E+ + EY+I++ + G + YV+E Sbjct: 136 KINPSKELIKEAILDNDFLKNLEASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEE 195 Query: 302 GVFDVLVTGDDRVEKVVHTYEGSG-SFGELALMYNMPRAASVRAQTAGALW 451 G V G V + G G +FGELA++YN R ASVRAQT+G LW Sbjct: 196 GKCQVTKEG------TVLGHMGPGKAFGELAILYNCTRTASVRAQTSGKLW 240 Score = 44.4 bits (100), Expect = 5e-05 Identities = 22/62 (35%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +2 Query: 152 EAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENG-VFDVLVTG 328 E +R + L + L + ++ D + E E GEY+IRQG GD F++I++G ++V G Sbjct: 264 EFLRSVNLLKDLAESYLLKIADVIEETFYEEGEYIIRQGARGDTFFIIKSGNGLCLVVDG 323 Query: 329 DD 334 +D Sbjct: 324 ED 325 >SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 58.0 bits (134), Expect = 4e-09 Identities = 35/128 (27%), Positives = 66/128 (51%), Gaps = 1/128 (0%) Frame = +2 Query: 44 RRKSVFAETYDPEEDDSDEGAPAV-FPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDA 220 +R++V E+ +++S G FPK + + +A+ ++L+A Q+++++D Sbjct: 442 KRQAVSGESSTKAQEESRTGKELERFPKDFRSKQLIKDAIFENDFLKNLEAAQVRKIVDC 501 Query: 221 MFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMY 400 M+ + + +I++GD G+ Y I +G V R KV+ FGELA++Y Sbjct: 502 MYSNTFQRNDVIIQEGDAGNALYAIADGRLQVT-----RENKVLGEMVAGMVFGELAILY 556 Query: 401 NMPRAASV 424 N R A+V Sbjct: 557 NCRRTATV 564 >SB_52453| Best HMM Match : cNMP_binding (HMM E-Value=1.9e-26) Length = 370 Score = 54.0 bits (124), Expect = 7e-08 Identities = 36/107 (33%), Positives = 58/107 (54%), Gaps = 4/107 (3%) Frame = +2 Query: 125 SDAQRARLAEA-VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIEN 301 S ++ R+ E + + + SLD + V DA+ + + G+ V+ QG+ GD F++I Sbjct: 227 SQIRKRRMYEQFLEKVSILESLDKWERLTVADALEPTQFQDGDDVVVQGEHGDEFFIIVE 286 Query: 302 GVFDVL---VTGDDRVEKVVHTYEGSGSFGELALMYNMPRAASVRAQ 433 G VL +D +E V S FGE+AL+ N PRAA+V+A+ Sbjct: 287 GTAVVLQRRSANEDFIE--VSRLGPSDYFGEIALVLNRPRAATVQAR 331 Score = 42.3 bits (95), Expect = 2e-04 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = +2 Query: 347 VVHTYEGSGSFGELALMYNMPRAASVRAQTAGALW 451 +V T GSFGELAL+Y PRAA+++A+T LW Sbjct: 179 LVSTIGEGGSFGELALIYGTPRAATIKAKTDVKLW 213 >SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 44.0 bits (99), Expect = 7e-05 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +2 Query: 44 RRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAM 223 RR SV E Y+P + A +PKS+ R RL + I +F+S Q+ +LDAM Sbjct: 291 RRDSVAGEVYEPVNSNC-VSAQRFYPKSEDARKRLENVIGNIFIFKSCGKDQINMMLDAM 349 Query: 224 FEK 232 + K Sbjct: 350 YIK 352 >SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) Length = 858 Score = 43.2 bits (97), Expect = 1e-04 Identities = 28/77 (36%), Positives = 38/77 (49%), Gaps = 2/77 (2%) Frame = +2 Query: 245 GEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGS-FGELALM-YNMPRAA 418 G+Y+ R G GD Y I+ G+ D+L E + T G GS FGE+ L+ R A Sbjct: 648 GDYICRSGHRGDKMYFIQKGIVDILTR-----EGALATSLGDGSHFGEICLLTKEARRVA 702 Query: 419 SVRAQTAGALWGHGPPH 469 SVRA T ++ H Sbjct: 703 SVRAATTCDVYSLSATH 719 >SB_56249| Best HMM Match : cNMP_binding (HMM E-Value=5.4e-23) Length = 279 Score = 42.3 bits (95), Expect = 2e-04 Identities = 22/66 (33%), Positives = 35/66 (53%) Frame = +2 Query: 239 EPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPRAA 418 +PG+Y++ GD G Y I G ++L + V+ T FGE+ L+Y R A Sbjct: 148 KPGDYIVYAGDMGREMYCIRRGQVNILCE-----DNVIGTLGPGSFFGEIGLIYGESRFA 202 Query: 419 SVRAQT 436 +V+A+T Sbjct: 203 TVQAKT 208 >SB_43598| Best HMM Match : cNMP_binding (HMM E-Value=4.3e-22) Length = 581 Score = 41.9 bits (94), Expect = 3e-04 Identities = 21/80 (26%), Positives = 44/80 (55%) Frame = +2 Query: 158 VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 337 +R + +F + +++++ + + PG+Y+ R+GD G Y++ +G V+ GDD Sbjct: 449 LRQVPVFADCEPGLLREIVVKLRSQVFSPGDYICRKGDVGREMYIVNSGCLQVV--GDDG 506 Query: 338 VEKVVHTYEGSGSFGELALM 397 + EGS FGE++++ Sbjct: 507 TTVLAILSEGS-YFGEISIL 525 >SB_16296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1152 Score = 41.9 bits (94), Expect = 3e-04 Identities = 21/62 (33%), Positives = 34/62 (54%) Frame = +2 Query: 242 PGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPRAAS 421 PG+++ RQG+ G Y++ G +VL D E V+ T FGE++L+ NM + Sbjct: 547 PGDFICRQGEKGREMYIVNKGSLEVL----DEKETVLATLSAGSHFGEISLL-NMKGIGN 601 Query: 422 VR 427 +R Sbjct: 602 LR 603 >SB_33011| Best HMM Match : cNMP_binding (HMM E-Value=0.037) Length = 210 Score = 40.3 bits (90), Expect = 9e-04 Identities = 21/81 (25%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = +2 Query: 158 VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 337 ++ + +F+ D + +++ + + PG+Y+ R G+ G Y+I +G +V+V Sbjct: 122 LKKVKIFKDCDEGLLCELVLKLRPQIFSPGDYICRCGEIGREMYIINHGKVEVVVPDSTT 181 Query: 338 VEKVVHTYEGSGS-FGELALM 397 EK+V G+ FGE++L+ Sbjct: 182 GEKIVVASLTEGNYFGEISLL 202 >SB_18428| Best HMM Match : cNMP_binding (HMM E-Value=0.037) Length = 210 Score = 40.3 bits (90), Expect = 9e-04 Identities = 21/81 (25%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = +2 Query: 158 VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 337 ++ + +F+ D + +++ + + PG+Y+ R G+ G Y+I +G +V+V Sbjct: 122 LKKVKIFKDCDEGLLCELVLKLRPQIFSPGDYICRCGEIGREMYIINHGKVEVVVPDSTT 181 Query: 338 VEKVVHTYEGSGS-FGELALM 397 EK+V G+ FGE++L+ Sbjct: 182 GEKIVVASLTEGNYFGEISLL 202 >SB_29572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 617 Score = 39.9 bits (89), Expect = 0.001 Identities = 18/82 (21%), Positives = 44/82 (53%) Frame = +2 Query: 152 EAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGD 331 +++R + +F+ +A + +++ + + PG+YV R+G+ G Y++ G +V+ Sbjct: 373 DSLRKVAIFQDCEAGFLCELVLRLRSQLFSPGDYVCRKGEVGREMYIVNRGKLEVV---S 429 Query: 332 DRVEKVVHTYEGSGSFGELALM 397 + K+ E FGE++++ Sbjct: 430 EHGTKIYAVLEAGSYFGEISVL 451 >SB_9442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 34.7 bits (76), Expect = 0.044 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 4/69 (5%) Frame = -1 Query: 346 LFDAVVSGDQDVENAVLDDVEVVAVIALSD-YVLAGLGSLFEHRIQNLL---HLLRVKRT 179 +F AVVS +NA L D + V+ +D Y+L GL L EH+I LL ++L V RT Sbjct: 40 VFAAVVSFVYR-DNAELTDEILYNVLCAADIYLLHGLKRLCEHKISGLLDRANVLTVLRT 98 Query: 178 EQQYAPDRL 152 + ++ DRL Sbjct: 99 ARLFSLDRL 107 >SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 34.7 bits (76), Expect = 0.044 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 4/69 (5%) Frame = -1 Query: 346 LFDAVVSGDQDVENAVLDDVEVVAVIALSD-YVLAGLGSLFEHRIQNLL---HLLRVKRT 179 +F AVVS +NA L D + V+ +D Y+L GL L EH+I LL ++L V RT Sbjct: 262 VFAAVVSFVYR-DNAELTDEILYNVLCAADIYLLHGLKRLCEHKISGLLDRANVLTVLRT 320 Query: 178 EQQYAPDRL 152 + ++ DRL Sbjct: 321 ARLFSLDRL 329 >SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) Length = 1211 Score = 34.3 bits (75), Expect = 0.059 Identities = 22/86 (25%), Positives = 38/86 (44%) Frame = +2 Query: 173 LFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVV 352 LF+ L+ + ++ + R ++RQG+ G+ FY+I G V D E Sbjct: 784 LFKLLEDDALLDIIKNVTLTRYRKDNIIMRQGEKGNCFYIILKGSVSVYAKQDGDGEAAT 843 Query: 353 HTYEGSGSFGELALMYNMPRAASVRA 430 H + S E L++ +S+RA Sbjct: 844 HHEQSVRSHKERLLLFG-AELSSLRA 868 >SB_11282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 34.3 bits (75), Expect = 0.059 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 14/76 (18%) Frame = +2 Query: 239 EPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRV--------------EKVVHTYEGSGS 376 E +I+QG G +FY I +G V +DR K++ G S Sbjct: 185 EQDRVIIKQGHIGVSFYFIVSGSVVVQRVEEDRTTGEKHNQSMIIAYFSKIISEMTGGDS 244 Query: 377 FGELALMYNMPRAASV 424 FGELALM+++ R A++ Sbjct: 245 FGELALMHDIRRTATI 260 >SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 33.9 bits (74), Expect = 0.077 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +3 Query: 15 KSRQWRALTIGANPFSPRLMTPKRMILTKEPLPCSPSRTHREPVSLRRS 161 KS + RA ++ ++P+ +TPK ++ ++ L PSR P S +R+ Sbjct: 603 KSARTRAWSVSPRLYTPKSITPKFILSPRQTLSAPPSRPKTAPTSAQRT 651 >SB_16528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 33.5 bits (73), Expect = 0.10 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 230 KRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTG 328 +R PG+Y+I+QGD+ Y I G +VL G Sbjct: 81 RRHLPGQYLIKQGDEVKKLYFIAKGFVEVLKDG 113 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 33.1 bits (72), Expect = 0.14 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 452 PTERRRSGPVQMPPAACCTSGPVRQTNRNLRMCGPP 345 PT SGP++ PAA SGP + RN+R P Sbjct: 1066 PTHTPNSGPLEENPAASSPSGPPAKQRRNVRFVANP 1101 >SB_3342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 33.1 bits (72), Expect = 0.14 Identities = 18/63 (28%), Positives = 34/63 (53%) Frame = +2 Query: 248 EYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPRAASVR 427 +Y++ +GD G +I+ G +V +TG+D +V+ E +G+ L+ P ++R Sbjct: 816 DYILHKGDIGQQLIIIKRGTAEV-ITGED--PEVILPLEEMSFYGDRYLLAPGPHLETLR 872 Query: 428 AQT 436 A T Sbjct: 873 AVT 875 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 32.7 bits (71), Expect = 0.18 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 4/80 (5%) Frame = +2 Query: 107 PAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNF 286 PA F + Q + A A+ G+ + R ++ + M +K E V G G F Sbjct: 845 PAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKKEGEKNILVFDLG--GGTF 902 Query: 287 YV----IENGVFDVLVTGDD 334 V I+NGVF+V+ T D Sbjct: 903 DVSLLTIDNGVFEVVATNGD 922 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 32.3 bits (70), Expect = 0.24 Identities = 27/97 (27%), Positives = 38/97 (39%), Gaps = 1/97 (1%) Frame = -2 Query: 387 SSPNEPEPSYVWTTFSTRSSPVT-RTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASR 211 S+P+ P T ST S+P T T TP + +PS+PC + +P + + S Sbjct: 19 STPSTPSTPSTPRTPSTPSTPCTPSTPSTPSTPITPSTPSTPCTHS-TPSAPSTPSTPST 77 Query: 210 TCCICCASRERNSSMPRTASARRALCASDLGNTAGAP 100 C S S P T S A +T P Sbjct: 78 PCTPSTPSTPSTPSTPSTPSTPSAPSTPSTPSTPSTP 114 Score = 29.9 bits (64), Expect = 1.3 Identities = 27/96 (28%), Positives = 37/96 (38%) Frame = -2 Query: 387 SSPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASRT 208 S PN P +T ST S+P+ T TP + + +PS P +P + + S Sbjct: 220 SMPNTPSTPSTPSTPSTLSTPI--TPSTPSTPSTPSTPSMPS----TPSTPSTPSTPSTP 273 Query: 207 CCICCASRERNSSMPRTASARRALCASDLGNTAGAP 100 C S SMP T S +T AP Sbjct: 274 CTPNTPSTPSTPSMPSTPSTPSTPSTPSTPSTPSAP 309 Score = 29.9 bits (64), Expect = 1.3 Identities = 27/96 (28%), Positives = 37/96 (38%) Frame = -2 Query: 387 SSPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASRT 208 S PN P +T ST S+P+ T TP + + +PS P +P + + S Sbjct: 770 SMPNTPSTPSTPSTPSTLSTPI--TPSTPSTPSTPSTPSMPS----TPSTPSTPSTPSTP 823 Query: 207 CCICCASRERNSSMPRTASARRALCASDLGNTAGAP 100 C S SMP T S +T AP Sbjct: 824 CTPNTPSTPSTPSMPSTPSTPSTPSTPSTPSTPSAP 859 >SB_33629| Best HMM Match : Extensin_2 (HMM E-Value=2.2) Length = 958 Score = 32.3 bits (70), Expect = 0.24 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 1/84 (1%) Frame = +2 Query: 32 RFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGI-LLFRSLDAQQMQQ 208 ++NN + + +P+ D+ V PK D Q R EAV + L + D Q Q Sbjct: 272 QYNNADGPIQDQYNNPDGPIQDQNESHVGPKQDQQEERSTEAVGDLPALIANTDQWQAQG 331 Query: 209 VLDAMFEKRSEPGEYVIRQGDDGD 280 +A P E V + +D D Sbjct: 332 DDEATQNHDDNPNERVTEKPEDAD 355 >SB_17979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 31.9 bits (69), Expect = 0.31 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Frame = +2 Query: 245 GEYVIRQGDDGDNFYVIENGVFDVLVTGD-DRVEKVVHTYEGSGSFGELALMYNMPRAAS 421 GEY+IR+GD G +++ G ++ + D +++E++V + + + L+ P S Sbjct: 212 GEYIIRKGDIGQQLIILKRGTAAIVKSEDPEKLEEMV----VNSFYSQRYLLLTGPYLES 267 Query: 422 VRAQT 436 VRA T Sbjct: 268 VRAIT 272 >SB_50313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 31.5 bits (68), Expect = 0.41 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 242 PGEYVIRQGDDGDNFYVIENGVFDVLVTG 328 PG Y+I++GD+ Y + G DV+ +G Sbjct: 50 PGHYIIKEGDEVKYLYFVVEGTVDVIKSG 78 >SB_48433| Best HMM Match : Ion_trans (HMM E-Value=6.1e-26) Length = 1344 Score = 31.5 bits (68), Expect = 0.41 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 5/70 (7%) Frame = +2 Query: 242 PGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSG-SFGE-LALMYNMPRA 415 PG+++I QGD+ + Y + G +VL DD + ++ G G SFGE L N P Sbjct: 1004 PGDFIIYQGDEISHLYFLVRGTVEVL--KDDTIMAIL----GKGDSFGENFGLSPNRPPG 1057 Query: 416 ---ASVRAQT 436 S+RA T Sbjct: 1058 NSHVSIRALT 1067 >SB_44245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 404 Score = 31.5 bits (68), Expect = 0.41 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -2 Query: 471 TCGGPWPHRAPAVWARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPV 322 TC GP P + A + ++ SS +P PS +W F+ S V Sbjct: 74 TCSGPVPSELLITPGKAFKALSRIKVKKSSGPDPVPSVIWKEFAPELSEV 123 >SB_27819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 383 Score = 31.5 bits (68), Expect = 0.41 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -2 Query: 471 TCGGPWPHRAPAVWARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPV 322 TC GP P + A + ++ SS +P PS +W F+ S V Sbjct: 199 TCSGPVPSELLITPGKAFKALSRIKVKKSSGPDPVPSVIWKEFAPELSEV 248 >SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) Length = 816 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/52 (23%), Positives = 29/52 (55%) Frame = +2 Query: 173 LFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTG 328 LF ++ ++ + M + PG +++ +GD+ D ++I+ G +++V G Sbjct: 480 LFMDSESSCLRGISMRMRRQYHLPGHFIMYEGDEVDTLHLIKRGKIEIIVNG 531 >SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) Length = 710 Score = 31.1 bits (67), Expect = 0.55 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -2 Query: 471 TCGGPWPHRAPAVWARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPV 322 TC GP P + A + ++ SS +P PS +W F+ S V Sbjct: 287 TCSGPVPPELLITPGKAFKALSRIKVKKSSGPDPVPSVIWKEFAPELSDV 336 >SB_25036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 30.7 bits (66), Expect = 0.72 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = -2 Query: 471 TCGGPWPHRAPAVWARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSS 328 TC GP P + A L ++ SS +P PS +W F+ S Sbjct: 34 TCSGPVPPELLITPGKAFKALSRLKVKKSSGPDPVPSVIWKEFAPELS 81 >SB_21541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 30.7 bits (66), Expect = 0.72 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 33 ALTIGANPFSPRLMTPKRMILTKEPLPCSPSRTHREPVSL 152 ALT + PFSP + P + LT P SP++ P SL Sbjct: 61 ALTAYSRPFSPDSLFPPPLALTAYSRPFSPAKLIARPFSL 100 >SB_7619| Best HMM Match : ArfGap (HMM E-Value=5.3) Length = 483 Score = 30.7 bits (66), Expect = 0.72 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -2 Query: 471 TCGGPWPHRAPAVWARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPV 322 TC GP P + A + ++ SS +P PS +W F+ S V Sbjct: 154 TCSGPVPPELLITPGKAFKALSRIKVKKSSGPDPVPSVIWKEFAPELSVV 203 >SB_26738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -2 Query: 471 TCGGPWPHRAPAVWARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPV 322 TC GP P + A + ++ SS +P PS +W F+ S V Sbjct: 25 TCLGPVPPELLITPGKAFKALSRIKVKKSSGPDPVPSVIWKEFAPELSDV 74 >SB_44854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 403 VVHQGQFAKRTGTFVCVDHLFDAVV 329 +VH G RTGTF+ +D L D +V Sbjct: 489 LVHCGAGVGRTGTFIAIDSLMDQMV 513 >SB_16017| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-19) Length = 879 Score = 29.1 bits (62), Expect = 2.2 Identities = 19/66 (28%), Positives = 28/66 (42%) Frame = -2 Query: 453 PHRAPAVWARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSP 274 P RA A+ TD + LY+R S + ++W S S P + F S Sbjct: 580 PFRAHAIRISTDIEKAFLYVRLSEADRDMTRFLW--LSDPSDPESAFQTYRFKSVLFGSA 637 Query: 273 SSPCLI 256 SSP ++ Sbjct: 638 SSPFML 643 >SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 998 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 72 MTPKRMILTKEPLPCSPSRTHRE 140 MTP R LT LPC SRT+ E Sbjct: 941 MTPSRASLTPTHLPCRDSRTNSE 963 >SB_52670| Best HMM Match : FxsA (HMM E-Value=2.5) Length = 112 Score = 28.7 bits (61), Expect = 2.9 Identities = 29/109 (26%), Positives = 48/109 (44%), Gaps = 2/109 (1%) Frame = -1 Query: 346 LFDAVVSGDQDVENAVLDDVEVVAVIAL-SDYVLAGLGSLFEHRIQNLLHLLRVKRTEQQ 170 +F V++ + +L + VA++ L S Y A + + ++ N L R + E++ Sbjct: 4 IFTIVINVYASIALQILIAIGAVALVTLTSSYATAFINVKKQRQLHNQSDLQRTIQKERE 63 Query: 169 YAPDRLSET-GSLCVRLGEHGRGSFVRIILFGVISLGENGFAPIVKARH 26 A L T SL L G G F V +N F P+V++RH Sbjct: 64 LAKTLLLVTITSLLTWLPLIGAGMGPMFPSFDVF---DNQFEPVVQSRH 109 >SB_5902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 222 IASRTCCICCASRERNSS 169 IAS CC CC R R+SS Sbjct: 402 IASCICCCCCCCRRRSSS 419 >SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -1 Query: 379 KRTGTFVCVDHLFDAVVSGDQDVENAVLDDVE 284 K + FVCVDH + V DV A+L VE Sbjct: 105 KHSSQFVCVDHDAEYVPGSGADVNGALLYPVE 136 >SB_29857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1264 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 406 AAGGICTGPDRRRSVGPWTATRFLRXLLKSAFKK 507 A G +C R RS+G W T+ + AFK+ Sbjct: 154 AGGRLCVSGSRDRSIGIWDLTKLTEEEPQKAFKQ 187 >SB_29710| Best HMM Match : LHC (HMM E-Value=3.3) Length = 343 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 298 LDDVEVVAVIALSDYVLAGLGSLFEHRI 215 ++ V++ VIAL D V+AG +L HR+ Sbjct: 311 MEQVQLAGVIALLDVVVAGSTALIAHRL 338 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 28.3 bits (60), Expect = 3.8 Identities = 20/52 (38%), Positives = 23/52 (44%) Frame = -2 Query: 390 ASSPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSD 235 A S N P P TT SS T +S S T SPSS + +PG D Sbjct: 962 APSLNNPNPRSSCTT--PPSSDTTNSSSAGPSATNNASPSSSPYVASAPGKD 1011 >SB_57887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 298 LDDVEVVAVIALSDYVLAGLGSLFEHRI 215 ++ V++ VIAL D V+AG +L HR+ Sbjct: 498 MEQVQLAGVIALLDVVVAGSTALIAHRL 525 >SB_19362| Best HMM Match : M (HMM E-Value=0.0014) Length = 722 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 266 GDDGDNFYVIENGVFDV---LVTGDDRVEKVVHTYEGS 370 G DG+ + IENG DV L+ ++R+ +++ YEG+ Sbjct: 204 GRDGNKYMGIENGKADVSEKLLQENERLRELLRQYEGN 241 >SB_14508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1392 Score = 28.3 bits (60), Expect = 3.8 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = +2 Query: 164 GILLFRSLDA-QQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRV 340 G L+ +LD+ Q+ +V D F E + GD +++EN L +GD + Sbjct: 37 GSLVENALDSGDQLIEVRDMTFIGTGSLVENALDSGDQLIEAHLVENA----LDSGDQLI 92 Query: 341 EKVVHTYEGSGSFGELAL 394 E T+ G+GS E AL Sbjct: 93 EVRDMTFIGTGSLVEYAL 110 >SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) Length = 405 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 23 PVARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSD 130 P + S AE P E DS+EG P + P D Sbjct: 276 PAEPVEQSQDSGVAEAESPAEQDSEEGTPGMSPPVD 311 >SB_35537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 27.5 bits (58), Expect = 6.7 Identities = 17/67 (25%), Positives = 26/67 (38%) Frame = -2 Query: 453 PHRAPAVWARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSP 274 PH VW + +SSP VWT S+ + + T F K P Sbjct: 81 PHLR-VVWISAQVDVMGFHAESSSPTGTVMLIVWTILPQLSTSIVHCATTAFPRFNKEMP 139 Query: 273 SSPCLIT 253 ++P ++T Sbjct: 140 TNPLILT 146 >SB_3203| Best HMM Match : FGF (HMM E-Value=0.013) Length = 423 Score = 27.5 bits (58), Expect = 6.7 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = -1 Query: 196 LRVKRTEQQYAPDRLSETGSLCVRLGEHGRGSFVRIILFG--VISLGENGFAPIVKARHW 23 +R+ R + Y RL G + +RL HG+ ++R+ G I L +G I RH Sbjct: 266 IRLNRHGKMYI--RLDRNGKMYIRLNRHGK-MYIRLNRHGKMYIRLNRHGKMYIRLNRHG 322 Query: 22 RLFYKI 5 +++ ++ Sbjct: 323 KMYIRL 328 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 27.1 bits (57), Expect = 8.9 Identities = 18/61 (29%), Positives = 26/61 (42%) Frame = -2 Query: 285 KLSPSSPCLITYSPGSDLFSNIASRTCCICCASRERNSSMPRTASARRALCASDLGNTAG 106 K +P+SP L S G D + + CI S R A+ + A C + NT G Sbjct: 311 KSAPTSPDLTLASAGKDTRKRLNYHSQCIDVDECTEMSPRCRCANQKSASCNATCINTLG 370 Query: 105 A 103 + Sbjct: 371 S 371 >SB_18513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4634 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/57 (26%), Positives = 23/57 (40%) Frame = +2 Query: 239 EPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMP 409 +P + IR+G DGD V+ D T K V + GE + ++P Sbjct: 172 QPANFTIRRGGDGDTEIVVTYSTVDGTATASSADYKAVAFGRVTMGVGEFSKEISIP 228 >SB_49169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 27.1 bits (57), Expect = 8.9 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 26 VARFNNRRKSVFAETYDPEEDDSDEGAPAVFP--KSDAQRARLAEAV 160 V R K A+ D E D +EGAPA P K RA L E + Sbjct: 114 VDRVKKMHKKKMAKKEDEEMDVPEEGAPAKKPAVKKLGSRAALRECI 160 >SB_47365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = +3 Query: 87 MILTKEPLPCSPSRTHREPVSLRRSGAYCCSVLLTRSKCSRFWMRCSKRDPS 242 MI E P P P++ + T S+FWM+CS R+ S Sbjct: 442 MIAEDEARPVLPDAPRYPPIN--SGDKIALKMSYTSGDLSKFWMKCSDRECS 491 >SB_37674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 14 KKPPVARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSD 130 +K PV+ + S E +PE+ D+ E PA P S+ Sbjct: 492 RKSPVSEAEAPKPSAAKEEAEPEQMDTSEPEPAKEPSSE 530 >SB_36054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1267 Score = 27.1 bits (57), Expect = 8.9 Identities = 34/100 (34%), Positives = 42/100 (42%), Gaps = 5/100 (5%) Frame = -2 Query: 390 ASSPNEPEPSYVWTTFSTRSSP-VTRTSKTPFS-MT*KLSPSSPCLIT---YSPGSDLFS 226 A SPN P V S +SSP +TR P S T K+ S T SPG S Sbjct: 88 APSPNCP----VSMKTSGQSSPRLTRHLARPMSPSTTKIFARSSVPFTGHHVSPGGGTDS 143 Query: 225 NIASRTCCICCASRERNSSMPRTASARRALCASDLGNTAG 106 TCC C + S+ ++ A RALC + L G Sbjct: 144 RC---TCCCCTEDLLKIQSLLSSSFADRALCETMLTEMNG 180 >SB_27965| Best HMM Match : Sec61_beta (HMM E-Value=0.84) Length = 1737 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 364 FVCVDHLFDAVVSGDQDVENAVLDDVE 284 F+ +DH D+V S D ENAV ++E Sbjct: 1115 FINLDHESDSVKSSVADAENAVPSEIE 1141 >SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = +3 Query: 87 MILTKEPLPCSPSRTHREPVSLRRSGAYCCSVLLTRSKCSRFWMRCSKRDPS 242 MI E P P P++ + T S+FWM+CS R+ S Sbjct: 32 MIAEDEARPVLPDAPRYPPIN--SGDKIALKMSYTSGDLSKFWMKCSDRECS 81 >SB_7359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 27.1 bits (57), Expect = 8.9 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -2 Query: 429 ARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPVTRTSKTPF 298 +R +A L I+ SSP + S V +T++T + VT T PF Sbjct: 98 SRGNATIDWLAIQGSSPTMQQGSVVLSTWTTGTQCVTVTLPKPF 141 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,377,732 Number of Sequences: 59808 Number of extensions: 391886 Number of successful extensions: 1629 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 1438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1602 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -