BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30528 (508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 28 0.16 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 0.64 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 0.64 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 26 0.64 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 26 0.64 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 24 2.6 AY331406-1|AAQ97587.1| 96|Anopheles gambiae agCP14332 protein. 24 3.4 AY331405-1|AAQ97586.1| 96|Anopheles gambiae agCP14332 protein. 24 3.4 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 4.5 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 7.9 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 28.3 bits (60), Expect = 0.16 Identities = 25/77 (32%), Positives = 35/77 (45%) Frame = -2 Query: 357 VWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASRTCCICCASRER 178 VW+ S R+ RT ++ MT + +PSSP L S TC + C+S Sbjct: 25 VWSMASNRTVRCPRTRRSEAVMT-RSTPSSPRLAQAS------------TCPVPCSSIWS 71 Query: 177 NSSMPRTASARRALCAS 127 S R A AR A C++ Sbjct: 72 RPSSMRCAPARTASCST 88 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 26.2 bits (55), Expect = 0.64 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 298 LDDVEVVAVIALSDYVLAGLGSLFEHRIQNLL 203 L DVEV + AL D++ G ++ +H +QN L Sbjct: 119 LRDVEVNEMRALLDFMYQGEVNVGQHNLQNFL 150 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 26.2 bits (55), Expect = 0.64 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 298 LDDVEVVAVIALSDYVLAGLGSLFEHRIQNLL 203 L DVEV + AL D++ G ++ +H +QN L Sbjct: 119 LRDVEVNEMRALLDFMYQGEVNVGQHNLQNFL 150 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 26.2 bits (55), Expect = 0.64 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 298 LDDVEVVAVIALSDYVLAGLGSLFEHRIQNLL 203 L DVEV + AL D++ G ++ +H +QN L Sbjct: 71 LRDVEVNEMRALLDFMYQGEVNVGQHNLQNFL 102 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 26.2 bits (55), Expect = 0.64 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 298 LDDVEVVAVIALSDYVLAGLGSLFEHRIQNLL 203 L DVEV + AL D++ G ++ +H +QN L Sbjct: 119 LRDVEVNEMRALLDFMYQGEVNVGQHNLQNFL 150 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 24.2 bits (50), Expect = 2.6 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -2 Query: 207 CCICCASRERNSSMPRTASARRALCASDLGNTAGA 103 CC CCAS N M S A + N +GA Sbjct: 549 CCFCCAS--SNGPMEGAESKAAAYLRQNTINQSGA 581 >AY331406-1|AAQ97587.1| 96|Anopheles gambiae agCP14332 protein. Length = 96 Score = 23.8 bits (49), Expect = 3.4 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 443 RRRSGPVQMPPAACCTSGPVRQTNRNLRMCGPP 345 R + GP AA T G VR+ R +CG P Sbjct: 36 RMKEGPNVENGAANLTPGNVRRRTRCGSLCGSP 68 >AY331405-1|AAQ97586.1| 96|Anopheles gambiae agCP14332 protein. Length = 96 Score = 23.8 bits (49), Expect = 3.4 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 443 RRRSGPVQMPPAACCTSGPVRQTNRNLRMCGPP 345 R + GP AA T G VR+ R +CG P Sbjct: 36 RMKEGPNVENGAANLTPGNVRRRTRCGSLCGSP 68 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 74 DPEEDDSDEGAPAVFPKSDAQRARLAEA 157 D EE++ +E P V K + ARL+ + Sbjct: 46 DGEEEEDEEEGPGVRQKQSSPPARLSSS 73 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 7.9 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +2 Query: 386 LALMYNMPRAASVRAQTAGALWGHGPPHVSFAXCSRAHSRN 508 L + +N P AQ G G HV F A SRN Sbjct: 632 LVIRWNSPANYRSYAQCKGRAKAPGAYHVLFVTPENAASRN 672 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,570 Number of Sequences: 2352 Number of extensions: 11796 Number of successful extensions: 54 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -