BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30528 (508 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / po... 53 1e-07 At5g37500.1 68418.m04516 guard cell outward rectifying K+ channe... 48 3e-06 At2g26650.1 68415.m03197 potassium channel protein 1 (AKT1) iden... 42 2e-04 At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel... 37 0.007 At4g22200.1 68417.m03209 potassium channel protein 2 (AKT2) (AKT... 36 0.021 At5g53130.1 68418.m06604 cyclic nucleotide-regulated ion channel... 35 0.036 At4g32650.2 68417.m04648 inward rectifying potassium channel, pu... 34 0.048 At4g32650.1 68417.m04647 inward rectifying potassium channel, pu... 34 0.048 At2g28260.1 68415.m03430 cyclic nucleotide-regulated ion channel... 32 0.19 At1g31150.1 68414.m03811 expressed protein EST gb|Z33866 comes f... 32 0.26 At5g14870.1 68418.m01744 cyclic nucleotide-regulated ion channel... 31 0.34 At4g30360.1 68417.m04314 cyclic nucleotide-regulated ion channel... 31 0.45 At2g40475.1 68415.m04995 expressed protein 31 0.45 At1g01710.1 68414.m00089 acyl-CoA thioesterase family protein co... 31 0.45 At1g19780.1 68414.m02473 cyclic nucleotide-regulated ion channel... 30 0.78 At1g15990.1 68414.m01918 cyclic nucleotide-regulated ion channel... 30 0.78 At1g01340.1 68414.m00049 cyclic nucleotide-regulated ion channel... 30 0.78 At2g28690.1 68415.m03487 expressed protein 30 1.0 At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)... 29 1.4 At4g00510.1 68417.m00070 cyclic nucleotide-binding domain-contai... 29 1.8 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 29 1.8 At1g77460.1 68414.m09020 C2 domain-containing protein / armadill... 29 1.8 At5g22170.1 68418.m02581 hypothetical protein 29 2.4 At3g48010.1 68416.m05234 cyclic nucleotide-regulated ion channel... 29 2.4 At3g08670.1 68416.m01007 expressed protein 29 2.4 At2g19440.1 68415.m02269 glycosyl hydrolase family 17 protein si... 28 3.1 At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)... 28 4.2 At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)... 28 4.2 At5g40590.1 68418.m04926 DC1 domain-containing protein predicted... 28 4.2 At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)... 28 4.2 At4g33480.1 68417.m04755 expressed protein 27 5.5 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 27 5.5 At1g51915.1 68414.m05852 cryptdin protein-related contains weak ... 27 5.5 At1g08400.1 68414.m00929 chromosome structural maintenance prote... 27 5.5 At5g18220.1 68418.m02138 glycosyl hydrolase family 17 protein si... 27 7.3 At2g17740.1 68415.m02055 DC1 domain-containing protein 27 7.3 At1g64760.1 68414.m07343 glycosyl hydrolase family 17 protein si... 27 7.3 At1g18860.1 68414.m02348 WRKY family transcription factor contai... 27 7.3 At4g29050.1 68417.m04155 lectin protein kinase family protein co... 27 9.6 At3g04010.1 68416.m00422 glycosyl hydrolase family 17 protein si... 27 9.6 At1g80070.1 68414.m09373 splicing factor, putative strong simila... 27 9.6 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 27 9.6 At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein ... 27 9.6 At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-rel... 27 9.6 >At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / potassium channel protein identical to SKOR [Arabidopsis thaliana] gi|3810676|emb|CAA11280; member of the 1 pore, 6 transmembrane (1P/6TM) Shaker K+ channel family, PMID:11500563 Length = 828 Score = 52.8 bits (121), Expect = 1e-07 Identities = 25/90 (27%), Positives = 50/90 (55%) Frame = +2 Query: 158 VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 337 + + LFR ++ + Q++ + E+ PGE ++ QG D Y + +GV + + D Sbjct: 398 IEKVPLFRGCSSEFINQIVIRLHEEFFLPGEVIMEQGSVVDQLYFVCHGVLEEIGITKDG 457 Query: 338 VEKVVHTYEGSGSFGELALMYNMPRAASVR 427 E++V + SFGE++++ N+P+ +VR Sbjct: 458 SEEIVAVLQPDHSFGEISILCNIPQPYTVR 487 >At5g37500.1 68418.m04516 guard cell outward rectifying K+ channel (GORK) identical to guard cell outward rectifying K+ channel [Arabidopsis thaliana] gi|11414742|emb|CAC17380; member of the 1 pore, 6 transmembrane (1P/6TM) Shaker K+ channel family, PMID:11500563 Length = 820 Score = 48.4 bits (110), Expect = 3e-06 Identities = 24/90 (26%), Positives = 49/90 (54%) Frame = +2 Query: 158 VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 337 ++ + LF+ + + Q++ + E+ PGE + QG+ D+ Y + G+ + LVT D Sbjct: 381 IKKVPLFKGCSTEFINQIVIRLHEEYFLPGEVITEQGNVVDHLYFVCEGLLEALVTKTDG 440 Query: 338 VEKVVHTYEGSGSFGELALMYNMPRAASVR 427 E+ V SFG+++++ N+ + +VR Sbjct: 441 SEESVTLLGPHTSFGDISIICNISQPFTVR 470 >At2g26650.1 68415.m03197 potassium channel protein 1 (AKT1) identical to AKT1 [Arabidopsis thaliana] gi|563112|gb|AAA96810; member of the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+ channel family, PMID:11500563 Length = 857 Score = 42.3 bits (95), Expect = 2e-04 Identities = 25/89 (28%), Positives = 43/89 (48%) Frame = +2 Query: 167 ILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEK 346 + LFR + + Q++ M + P E VI Q + +FY++ NG D LV D E Sbjct: 370 VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTAD-LVDVDTGTES 428 Query: 347 VVHTYEGSGSFGELALMYNMPRAASVRAQ 433 +V + GE+ ++ P+ +VR + Sbjct: 429 IVREVKAGDIIGEIGVLCYRPQLFTVRTK 457 >At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel, putative (CNGC14) similar to cyclic nucleotide and calmodulin-regulated ion channel (GI:4581205) [Arabidopsis thaliana] Length = 726 Score = 37.1 bits (82), Expect = 0.007 Identities = 19/72 (26%), Positives = 31/72 (43%) Frame = +2 Query: 122 KSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIEN 301 + D QR + VR + LF +D Q + + + + S G Y++R+GD I Sbjct: 464 RRDIQRHLCLDLVRRVPLFAQMDDQLLDAICERLASSLSTQGNYIVREGDPVTEMLFIIR 523 Query: 302 GVFDVLVTGDDR 337 G + T R Sbjct: 524 GKLESSTTNGGR 535 >At4g22200.1 68417.m03209 potassium channel protein 2 (AKT2) (AKT3) identical to potassium channel [Arabidopsis thaliana] gi|1100898|gb|AAA97865; Note: also identical to AKT3 [Arabidopsis thaliana] gi|1172218|gb|AAA96153, which is a truncated version of AKT2, PMID:10852932; member of the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+ channel family, PMID:11500563; identical to cDNA inward-rectifying K+ channel (AKT3) GI:1172219 Length = 802 Score = 35.5 bits (78), Expect = 0.021 Identities = 22/98 (22%), Positives = 49/98 (50%) Frame = +2 Query: 155 AVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDD 334 +V + LF+ + + + ++ M + P E VI Q + D+ Y+I +G +++ + + Sbjct: 388 SVEKVYLFKGVSREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEME 447 Query: 335 RVEKVVHTYEGSGSFGELALMYNMPRAASVRAQTAGAL 448 R E V+ T FGE+ + P++ + + ++ L Sbjct: 448 R-ESVLGTLRCGDIFGEVGALCCRPQSYTFQTKSLSQL 484 >At5g53130.1 68418.m06604 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC1) almost identical to cyclic nucleotide-regulated ion channel 1 pir:T51354, GI:11357236 from [Arabidopsis thaliana] Length = 716 Score = 34.7 bits (76), Expect = 0.036 Identities = 29/121 (23%), Positives = 51/121 (42%), Gaps = 2/121 (1%) Frame = +2 Query: 65 ETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEP 244 ET +E++ P + + LA +R + +F +D Q + + D + Sbjct: 451 ETRGVDEENLLSNLPKDLRRDIKRHLCLALLMR-VPMFEKMDEQLLDALCDRLQPVLYTE 509 Query: 245 GEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSF-GELALMYNM-PRAA 418 Y++R+GD D I G + T R + Y G+G F GE L + + P ++ Sbjct: 510 ESYIVREGDPVDEMLFIMRGKLLTITTNGGRTGFLNSEYLGAGDFCGEELLTWALDPHSS 569 Query: 419 S 421 S Sbjct: 570 S 570 >At4g32650.2 68417.m04648 inward rectifying potassium channel, putative (KAT3) (AKT4) (KC1) identical to K+ inward rectifying channel protein KC1 [Arabidopsis thaliana] gi|4090537|gb|AAC98810; similar to (KAT1) K+ channel [Arabidopsis thaliana] gi|1165000|emb|CAA63601; Shaker-type channel (1P/6TM), PMID:11500563 Length = 597 Score = 34.3 bits (75), Expect = 0.048 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 1/88 (1%) Frame = +2 Query: 173 LFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVV 352 LF+ + Q++ + + P +I Q + +FYVI +G D++ + V + V Sbjct: 406 LFKGFPEGLLVQLVSQIQAEYFPPKMEIILQNEIPTDFYVIVSGGVDIIAS--KGVSEQV 463 Query: 353 HTYEGSGSF-GELALMYNMPRAASVRAQ 433 G GS GE+ +++N+P+ +VR + Sbjct: 464 LAKLGPGSMAGEIGVVFNIPQPFTVRTR 491 >At4g32650.1 68417.m04647 inward rectifying potassium channel, putative (KAT3) (AKT4) (KC1) identical to K+ inward rectifying channel protein KC1 [Arabidopsis thaliana] gi|4090537|gb|AAC98810; similar to (KAT1) K+ channel [Arabidopsis thaliana] gi|1165000|emb|CAA63601; Shaker-type channel (1P/6TM), PMID:11500563 Length = 662 Score = 34.3 bits (75), Expect = 0.048 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 1/88 (1%) Frame = +2 Query: 173 LFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVV 352 LF+ + Q++ + + P +I Q + +FYVI +G D++ + V + V Sbjct: 406 LFKGFPEGLLVQLVSQIQAEYFPPKMEIILQNEIPTDFYVIVSGGVDIIAS--KGVSEQV 463 Query: 353 HTYEGSGSF-GELALMYNMPRAASVRAQ 433 G GS GE+ +++N+P+ +VR + Sbjct: 464 LAKLGPGSMAGEIGVVFNIPQPFTVRTR 491 >At2g28260.1 68415.m03430 cyclic nucleotide-regulated ion channel, putative (CNGC15) similar to cyclic nucleotide and calmodulin-regulated ion channel (cngc6) GI:4581207 from [Arabidopsis thaliana] Length = 678 Score = 32.3 bits (70), Expect = 0.19 Identities = 24/99 (24%), Positives = 41/99 (41%), Gaps = 2/99 (2%) Frame = +2 Query: 122 KSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIEN 301 + D +R + VR + LF +D + + + + + G +++R+GD + I Sbjct: 454 RRDIKRHLCFDLVRRVPLFDQMDERMLDAICERLKPALCTEGTFLVREGDPVNEMLFIIR 513 Query: 302 GVFDVLVTGDDRVEKVVHTYEGSGSF-GELALMYNM-PR 412 G D T R G G F GE L + + PR Sbjct: 514 GHLDSYTTNGGRTGFFNSCLIGPGDFCGEELLTWALDPR 552 >At1g31150.1 68414.m03811 expressed protein EST gb|Z33866 comes from this gene Length = 673 Score = 31.9 bits (69), Expect = 0.26 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -1 Query: 229 FEHRIQNLLHLLRV-KRTEQQYAPDRLSETGSLCVR 125 FEH++++ LH+ R K+ +QQ D+L E +C R Sbjct: 607 FEHQLESSLHIARAHKQEQQQQQTDKLKENLMVCQR 642 >At5g14870.1 68418.m01744 cyclic nucleotide-regulated ion channel, putative (CNGC18) similar to cyclic nucleotide and calmodulin-regulated ion channel (cngc6) GI:4581207 from [Arabidopsis thaliana] Length = 706 Score = 31.5 bits (68), Expect = 0.34 Identities = 16/72 (22%), Positives = 28/72 (38%) Frame = +2 Query: 122 KSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIEN 301 + + QR VR + F +D Q + + + S G Y+ R+GD + + Sbjct: 432 RREIQRHLCLSLVRRVPFFSQMDDQLLDAICGCLVSSLSTAGTYIFREGDPVNEMLFVIR 491 Query: 302 GVFDVLVTGDDR 337 G + T R Sbjct: 492 GQIESSTTNGGR 503 >At4g30360.1 68417.m04314 cyclic nucleotide-regulated ion channel, putative (CNGC17) similar to cyclic nucleotide and calmodulin-regulated ion channel cngc5 GI:4581205 from [Arabidopsis thaliana] Length = 720 Score = 31.1 bits (67), Expect = 0.45 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +2 Query: 122 KSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGD 271 + D QR + VR + F +D Q + + + + G Y++R+GD Sbjct: 464 RRDIQRHLCLDLVRRVPFFSQMDDQLLDAICERLVSSLCTEGTYLVREGD 513 >At2g40475.1 68415.m04995 expressed protein Length = 193 Score = 31.1 bits (67), Expect = 0.45 Identities = 22/79 (27%), Positives = 35/79 (44%) Frame = -2 Query: 366 PSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASRTCCICCAS 187 PS+ W++ S+ SS +S P + + C +Y D ++S C Sbjct: 104 PSFSWSSASSSSSSSYSSSSPPSKVEHRPRKCYSCSRSYVKEDDEEEIVSSSPTSTLCYK 163 Query: 186 RERNSSMPRTASARRALCA 130 R +SSM S +RALC+ Sbjct: 164 RGFSSSM---GSMKRALCS 179 >At1g01710.1 68414.m00089 acyl-CoA thioesterase family protein contains Pfam profiles: PF02551 acyl-CoA thioesterase, PF00027 cyclic nucleotide-binding domain Length = 427 Score = 31.1 bits (67), Expect = 0.45 Identities = 16/63 (25%), Positives = 31/63 (49%) Frame = +2 Query: 146 LAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVT 325 + E + + L + L + ++++ + KR G+YV+R+ D Y I G + V+ Sbjct: 6 VVEFLGNVPLLQKLPSSSLKKIAQVVVPKRYGKGDYVVREDQTWDGCYFILQG--EAQVS 63 Query: 326 GDD 334 G D Sbjct: 64 GPD 66 >At1g19780.1 68414.m02473 cyclic nucleotide-regulated ion channel, putative (CNGC8) similar to cyclic nucleotide and calmodulin-regulated ion channel GI:4581207 from (Arabidopsis thaliana) Length = 728 Score = 30.3 bits (65), Expect = 0.78 Identities = 19/91 (20%), Positives = 39/91 (42%) Frame = +2 Query: 65 ETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEP 244 ET +E++ + P + D +R VR + LF ++D + + + + + Sbjct: 448 ETRGVDEENIVQSLPKDL-RRDIKRHLCLNLVRRVPLFANMDERLLDAICERLKPSLYTE 506 Query: 245 GEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 337 Y++R+GD + I G + + T R Sbjct: 507 STYIVREGDPVNEMLFIIRGRLESVTTDGGR 537 >At1g15990.1 68414.m01918 cyclic nucleotide-regulated ion channel, putative (CNGC7) similar to cyclic nucleotide and calmodulin-regulated ion channel protein GI:4581207 from [Arabidopsis thaliana] Length = 709 Score = 30.3 bits (65), Expect = 0.78 Identities = 19/91 (20%), Positives = 39/91 (42%) Frame = +2 Query: 65 ETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEP 244 ET +E++ + P + D +R VR + LF ++D + + + + + Sbjct: 438 ETRGVDEENIVQSLPKDL-RRDIKRHLCLNLVRRVPLFANMDERLLDAICERLKPSLFTE 496 Query: 245 GEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 337 Y++R+GD + I G + + T R Sbjct: 497 STYIVREGDPVNEMMFIIRGRLESVTTDGGR 527 >At1g01340.1 68414.m00049 cyclic nucleotide-regulated ion channel (CNGC10) (ACBK1) almost identical to CaM-regulated potassium ion channel (ACBK1) GI:8515883 from [Arabidopsis thaliana]; contains Pfam domain, PF00520: Ion transport protein Length = 706 Score = 30.3 bits (65), Expect = 0.78 Identities = 22/89 (24%), Positives = 37/89 (41%), Gaps = 1/89 (1%) Frame = +2 Query: 65 ETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEP 244 ET EE+ P + D +R + ++ + LF +D Q + V D + Sbjct: 433 ETRGVEEETLLRNLPKDL-RRDIKRHLCLDLLKKVPLFEIMDEQLLDAVCDRLRPVLYTE 491 Query: 245 GEYVIRQGDD-GDNFYVIENGVFDVLVTG 328 YVIR+GD G+ +V+ + G Sbjct: 492 NSYVIREGDPVGEMLFVMRGRLVSATTNG 520 >At2g28690.1 68415.m03487 expressed protein Length = 231 Score = 29.9 bits (64), Expect = 1.0 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -1 Query: 232 LFEHRIQNLLHLLRVKRTEQQYAPDRLSE 146 L + ++NLLHLL++ R E+ A D+L + Sbjct: 41 LHQEEVKNLLHLLKLARQERDEAKDQLQK 69 >At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3) Similar to Arabidopsis luminal binding protein (gb|D89342); contains Pfam domain PF00012: dnaK protein Length = 678 Score = 29.5 bits (63), Expect = 1.4 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = +2 Query: 107 PAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPG--EYVIRQGDDGD 280 PA F + Q + A A+ G+ + R ++ + + +K E Y + G Sbjct: 193 PAYFNDAQRQATKDAGAIAGLNVVRIINEPTGAAIAYGLDKKGGESNILVYDLGGGTFDV 252 Query: 281 NFYVIENGVFDVLVTGDD 334 + I+NGVF+VL T D Sbjct: 253 SILTIDNGVFEVLSTSGD 270 >At4g00510.1 68417.m00070 cyclic nucleotide-binding domain-containing protein contains Pfam profile: PF00027 cyclic nucleotide-binding domain Length = 175 Score = 29.1 bits (62), Expect = 1.8 Identities = 17/87 (19%), Positives = 42/87 (48%), Gaps = 6/87 (6%) Frame = +2 Query: 146 LAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLV- 322 + E + + L + L + ++++ + + K + G+YV+R+ + D Y + G V Sbjct: 6 VVEFLGNVTLLQRLPSSSLKRISEVVVFKGYDRGDYVVRENQNVDGVYFLLQGQVRAQVL 65 Query: 323 --TGDDRVEKVV---HTYEGSGSFGEL 388 G++ ++ + + G G FG++ Sbjct: 66 RSAGEENYQEFPLKRYDFFGHGIFGDV 92 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 29.1 bits (62), Expect = 1.8 Identities = 20/47 (42%), Positives = 23/47 (48%) Frame = -2 Query: 384 SPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSP 244 SP+ P PS T ST S P K+P T K SPS P L + P Sbjct: 76 SPSTPIPS----TPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVP 118 >At1g77460.1 68414.m09020 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2110 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 382 AKRTGTFVCVDHLFDAVVSGDQDVENAVLD 293 A TF C+ HL A+ SG +DV+ VLD Sbjct: 1899 ASEAATF-CIPHLVGALKSGVEDVQGLVLD 1927 >At5g22170.1 68418.m02581 hypothetical protein Length = 179 Score = 28.7 bits (61), Expect = 2.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 461 VHGPTERRRSGPVQMPPAACCTS 393 +H P + RR GP + PA CC + Sbjct: 12 IHQPGQCRRRGPEDITPAHCCAT 34 >At3g48010.1 68416.m05234 cyclic nucleotide-regulated ion channel, putative (CNGC16) similar to cyclic nucleotide and calmodulin-regulated ion channel (cngc6) GI:4581207 from [Arabidopsis thaliana] Length = 705 Score = 28.7 bits (61), Expect = 2.4 Identities = 17/68 (25%), Positives = 27/68 (39%) Frame = +2 Query: 134 QRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFD 313 QR VR + F +D Q + + + + + YVIR+GD + I G + Sbjct: 444 QRHLCLALVRRVPFFAQMDDQLLDAICERLVPSLNTKDTYVIREGDPVNEMLFIIRGQME 503 Query: 314 VLVTGDDR 337 T R Sbjct: 504 SSTTDGGR 511 >At3g08670.1 68416.m01007 expressed protein Length = 567 Score = 28.7 bits (61), Expect = 2.4 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = -2 Query: 447 RAPAVWARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPVTRTSKTP 301 R+P+ T +A YIR SSP+ S + TR+S +R+S TP Sbjct: 174 RSPSSILNTSSASVSSYIRPSSPSSRSSSSARPSTPTRTSSASRSS-TP 221 >At2g19440.1 68415.m02269 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum]; an isoform contains a non-consensus GA-AG intron Length = 478 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = -1 Query: 136 LCVRLGEHG----RGSFVRIILFGVISLGENGFAPIVKARHWRLF 14 L RLGE+ R +++ + LFG++ AP RHW +F Sbjct: 284 LLPRLGENRGTPLRPTYIEVYLFGLLDEDAKSIAPGEFERHWGIF 328 >At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2) similar to SWISS-PROT: Q39043; GI:1303695; luminal binding protein (BiP) [Arabidopsis thaliana] Length = 613 Score = 27.9 bits (59), Expect = 4.2 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +2 Query: 107 PAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNF 286 PA F + Q + A + G+ + R ++ + + +K E V G + Sbjct: 179 PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDV 238 Query: 287 YV--IENGVFDVLVTGDD 334 V I+NGVF+VL T D Sbjct: 239 SVLTIDNGVFEVLSTNGD 256 >At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2) similar to SWISS-PROT: Q39043; GI:1303695; luminal binding protein (BiP) [Arabidopsis thaliana] Length = 668 Score = 27.9 bits (59), Expect = 4.2 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +2 Query: 107 PAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNF 286 PA F + Q + A + G+ + R ++ + + +K E V G + Sbjct: 179 PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDV 238 Query: 287 YV--IENGVFDVLVTGDD 334 V I+NGVF+VL T D Sbjct: 239 SVLTIDNGVFEVLSTNGD 256 >At5g40590.1 68418.m04926 DC1 domain-containing protein predicted protein, Arabidopsis thaliana Length = 234 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 2/20 (10%) Frame = -3 Query: 92 NHPLRGHKSRRKR--ICADC 39 NHPLRGHK K IC+ C Sbjct: 13 NHPLRGHKCEAKDEIICSGC 32 >At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1) SWISS-PROT:Q9LKR3 PMID:8888624 Length = 669 Score = 27.9 bits (59), Expect = 4.2 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +2 Query: 107 PAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNF 286 PA F + Q + A + G+ + R ++ + + +K E V G + Sbjct: 179 PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDV 238 Query: 287 YV--IENGVFDVLVTGDD 334 V I+NGVF+VL T D Sbjct: 239 SVLTIDNGVFEVLSTNGD 256 >At4g33480.1 68417.m04755 expressed protein Length = 336 Score = 27.5 bits (58), Expect = 5.5 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 406 HVVHQGQ-FAKRTGTFVCVDHLFDAVVSGDQDVENAVLDDVEV 281 H+VH G + R G D++FD QDVE + VE+ Sbjct: 221 HLVHSGFCYTARGGFCYTEDNVFDFRTDDGQDVEGLPTEGVEI 263 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 27.5 bits (58), Expect = 5.5 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -2 Query: 402 LYIRASSPNEPEPSYV-WTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGS 238 L + SSP P PS ++ S SP +S + LSPSSP ++ SP S Sbjct: 61 LSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSS 116 >At1g51915.1 68414.m05852 cryptdin protein-related contains weak similarity to Swiss-Prot:P17533 cryptdin-related protein 1C precursor (CRS1C) [Mus musculus] Length = 67 Score = 27.5 bits (58), Expect = 5.5 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 282 LSPSSPCLITYSPGSDLFSNIASRTC--CICCASRERNSSMP 163 LSP PC T + D + + R C C+CCA R + P Sbjct: 20 LSPILPCQATRAH-LDAETRMLRRVCPSCVCCAPAPRGACCP 60 >At1g08400.1 68414.m00929 chromosome structural maintenance protein-related contains weak similarity to RAD50-interacting protein 1 [Homo sapiens] gi|11967435|gb|AAG42101 Length = 804 Score = 27.5 bits (58), Expect = 5.5 Identities = 15/57 (26%), Positives = 30/57 (52%) Frame = -1 Query: 292 DVEVVAVIALSDYVLAGLGSLFEHRIQNLLHLLRVKRTEQQYAPDRLSETGSLCVRL 122 +V+ A++ + G+ F R++ +L LLR+ E+ LS +G+ C++L Sbjct: 731 EVDAEALLTVLKPYCVRPGAFFP-RVREILRLLRMHEEEKARLRGALSRSGNTCLKL 786 >At5g18220.1 68418.m02138 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 488 Score = 27.1 bits (57), Expect = 7.3 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = -1 Query: 136 LCVRLGEHGRGSFVRIILFGVISLGENGFAPIVKARHWRLF 14 L G R ++ + LFG I AP RHW +F Sbjct: 295 LAANRGTPMRPGYIEVYLFGFIDEDAKSIAPGNFERHWGIF 335 >At2g17740.1 68415.m02055 DC1 domain-containing protein Length = 248 Score = 27.1 bits (57), Expect = 7.3 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -3 Query: 92 NHPLRGHKSR--RKRICADC*SAPLAAFLQ 9 NHPLRGHK++ + IC+ C L A+ + Sbjct: 13 NHPLRGHKAQVEDEIICSGCDLDLLGAYFK 42 >At1g64760.1 68414.m07343 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 481 Score = 27.1 bits (57), Expect = 7.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 109 RGSFVRIILFGVISLGENGFAPIVKARHWRLF 14 R +++ + LFG++ AP RHW +F Sbjct: 301 RPTYIEVYLFGLLDEDAKSIAPGPFERHWGIF 332 >At1g18860.1 68414.m02348 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 480 Score = 27.1 bits (57), Expect = 7.3 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = -2 Query: 459 PWPHRAPAVWARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPVTRTSKTPF 298 P P A A+ + T AA ML ASS + FS + +T KT F Sbjct: 249 PLPMSATAMASATSAAASMLLSGASSSSSAAADLHGLNFSLSGNNITPKPKTHF 302 >At4g29050.1 68417.m04155 lectin protein kinase family protein contains Pfam domains, PF00138: Legume lectins alpha domain, PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 669 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 36 LTIGANPFSPRLMTPKRMILTKEPLPC 116 +T G P PR +P M+LT L C Sbjct: 538 ITCGRRPVLPRASSPSEMVLTDWVLDC 564 >At3g04010.1 68416.m00422 glycosyl hydrolase family 17 protein similar to beta-1,3-glucanase GB:S12402 [Nicotiana sp], GB:CAA03908 [Citrus sinensis], GB:S44364 [Lycopersicon esculentum] Length = 491 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -1 Query: 136 LCVRLGEHGRGSFVRIILFGVISLGENGFAPIVKARHWRLF 14 L +G R ++ + LFG I AP RHW +F Sbjct: 300 LANNVGTPMRKGYIEVYLFGFIDEDAKSVAPGNFERHWGIF 340 >At1g80070.1 68414.m09373 splicing factor, putative strong similarity to splicing factor Prp8 [Homo sapiens] GI:3661610; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 2382 Score = 26.6 bits (56), Expect = 9.6 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 8/49 (16%) Frame = +2 Query: 344 KVVHTYEGSGSFGELALMYNMPR--------AASVRAQTAGALWGHGPP 466 +V H Y S E Y MP+ A +R Q AG L+G PP Sbjct: 2133 RVNHIYVNSDDIKETGYTYIMPKNILKKFICVADLRTQIAGYLYGISPP 2181 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 26.6 bits (56), Expect = 9.6 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = -1 Query: 358 CVDHLFDAVVSGDQDVENAVLDDV 287 C+ HL A+ SG+Q+ ++ +D + Sbjct: 1912 CIPHLIGALKSGEQEARDSAMDTI 1935 >At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein contains Pfam profile: PF01363 FYVE zinc finger Length = 601 Score = 26.6 bits (56), Expect = 9.6 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 452 PTERRRSGPVQMPPAACCTSGPVRQTNRNLRMCGPPF 342 PT P PPA +GP T RN PPF Sbjct: 20 PTPNPNPNPNPSPPAPATVAGPTDLT-RNTYASAPPF 55 >At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-related similar to BEIGE (GI:3928547) [Rattus norvegicus]; Similar to gb|U70015 lysosomal trafficking regulator from Mus musculus and contains 2 Pfam PF00400 WD-40, G-beta repeats. ESTs gb|T43386 and gb|AA395236 come from this gene Length = 3601 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/42 (26%), Positives = 26/42 (61%) Frame = -1 Query: 373 TGTFVCVDHLFDAVVSGDQDVENAVLDDVEVVAVIALSDYVL 248 +G F C+ H+ A+++ D+ ++ + D+EVV+ + Y++ Sbjct: 188 SGIFCCLIHVLIALLAYDELSKSKITGDLEVVSAEKDAGYIV 229 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,824,653 Number of Sequences: 28952 Number of extensions: 258348 Number of successful extensions: 981 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 979 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -