BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30526 (356 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 1.5 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 24 2.0 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 3.4 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 4.5 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 22 6.0 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.2 bits (50), Expect = 1.5 Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Frame = +3 Query: 126 ADYDSAVEKSKHLYEEKKS-----EVITNVVNKLIRNNKMNCMEYAYQLWLQGSK 275 AD+ H+Y E+K ++ N + K R+N + M+Y + + + K Sbjct: 677 ADFCDVWINIAHIYVEQKQYISAIQMYENCLKKFYRHNNVEVMQYLARAYFRAGK 731 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.8 bits (49), Expect = 2.0 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = +3 Query: 84 NDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWL 263 +D +EQ Y + D + + + +E K E TNV + I ++ + + W Sbjct: 565 DDESKEQTYGDPKIEDNPTESVEIEWSLDETKREAKTNVADDTISESEFYGWDCSDDGWP 624 Query: 264 QG 269 QG Sbjct: 625 QG 626 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.0 bits (47), Expect = 3.4 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 4/33 (12%) Frame = +2 Query: 176 EERSHHKCSEQTDT----KQQDELHGVRLSTLA 262 EE+ H +C++Q++T KQ ++ S LA Sbjct: 484 EEKHHERCAKQSETTRIEKQLEQFESAPRSKLA 516 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 22.6 bits (46), Expect = 4.5 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 303 QLXNNHGRCPWSP 265 +L HG CPW P Sbjct: 247 RLTGVHGGCPWRP 259 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 22.2 bits (45), Expect = 6.0 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 232 TAWSTPINFGSRAPRTSSVIVXQLSSDLSSPK-TRXSLC 345 T WS N R PRT S SSP+ + S C Sbjct: 24 TVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTC 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 308,145 Number of Sequences: 2352 Number of extensions: 5077 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26224815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -