BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30523 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02210.1 68416.m00202 phytochelatin synthetase family protein... 29 1.9 At4g12440.1 68417.m01968 adenine phosphoribosyltransferase, puta... 29 2.5 At3g43540.1 68416.m04622 expressed protein hypothetical protein ... 29 2.5 At3g29810.1 68416.m03794 phytochelatin synthetase family protein... 29 2.5 At2g33420.1 68415.m04096 expressed protein 28 4.3 At2g41540.2 68415.m05134 NAD-dependent glycerol-3-phosphate dehy... 27 5.7 At2g41540.1 68415.m05133 NAD-dependent glycerol-3-phosphate dehy... 27 5.7 At5g60920.1 68418.m07642 phytochelatin synthetase, putative / CO... 27 7.5 At3g46610.1 68416.m05060 pentatricopeptide (PPR) repeat-containi... 27 7.5 At3g18860.2 68416.m02396 transducin family protein / WD-40 repea... 27 7.5 At3g18860.1 68416.m02395 transducin family protein / WD-40 repea... 27 7.5 At3g12380.1 68416.m01543 actin/actin-like family protein similar... 27 9.9 At1g48880.1 68414.m05476 hypothetical protein 27 9.9 >At3g02210.1 68416.m00202 phytochelatin synthetase family protein / COBRA cell expansion protein COBL3 similar to phytochelatin synthetase [Hordeum vulgare subsp. vulgare] GI:29570314; identified in Roudier, et al, Plant Phys. (2002) 130:538-548 (PMID:12376623); supported by cDNA: gi|26452134|dbj|AK118555.1; contains Pfam profile PF04833: Phytochelatin synthetase-like conserved region Length = 452 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = -3 Query: 484 EMSIENFRSYYSSLQYWHPVVRYPASSIITLLETFNHSFSSPYPLIDFSG 335 +++I NF +Y + W+ VV++P +T +FN+ +PY I+ +G Sbjct: 312 KVTITNF-NYNMNYSQWNLVVQHPNFDNLTQTFSFNYKPLTPYASINDTG 360 >At4g12440.1 68417.m01968 adenine phosphoribosyltransferase, putative strong similarity to SP|P31166 Adenine phosphoribosyltransferase 1 (EC 2.4.2.7) (APRT) {Arabidopsis thaliana}; contains Pfam profile PF00156: Phosphoribosyl transferase domain Length = 178 Score = 28.7 bits (61), Expect = 2.5 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 114 CKREDAIELLYSFFGSINLWGKILTEFQWVTI 19 C + + +SFF +I+L K+L F+W+ I Sbjct: 139 CAAMNLLSKFFSFFNNISLVPKLLLSFKWLPI 170 >At3g43540.1 68416.m04622 expressed protein hypothetical protein slr1699 - Synechocystis sp. (strain PCC 6803), PIR:S75306 Length = 373 Score = 28.7 bits (61), Expect = 2.5 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 1/94 (1%) Frame = +2 Query: 65 MLPKKL*SNSMASSRLQVTARQLSKTFKKKGRFEIGIASELPPAYKKFWREWKVLKPAAV 244 ++P L S + L VTA S+ K R + + PP +KK K L A V Sbjct: 15 LIPATLFSKRARALSLTVTATGGSRNNKVYTRLDSCLVIPPPPKFKKPRAIVKFLGGAFV 74 Query: 245 HFVPQ-EGKWKRDELTGETYPIQNIPIPLKFPAE 343 VP+ + ++ L E Y I ++P + F E Sbjct: 75 GAVPELTYSYLKELLAKEGYLIVSVPYNVTFDHE 108 >At3g29810.1 68416.m03794 phytochelatin synthetase family protein / COBRA cell expansion protein COBL2 similar to phytochelatin synthetase [Hordeum vulgare subsp. vulgare] GI:29570314; identified in Roudier, et al, Plant Phys. (2002) 130:538-548 (PMID:12376623); contains Pfam profile PF04833: Phytochelatin synthetase-like conserved region Length = 441 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = -3 Query: 484 EMSIENFRSYYSSLQYWHPVVRYPASSIITLLETFNHSFSSPY 356 +++I NF +Y + W+ VV++P +T L +FN+ +PY Sbjct: 303 KVAITNF-NYNMNYSQWNLVVQHPNFDNLTKLFSFNYKPLNPY 344 >At2g33420.1 68415.m04096 expressed protein Length = 1039 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +3 Query: 294 KLIRYKIFLFLLNSPLKSMRGYGEEKL 374 KL R +++ LLNS L SM+G+ E++L Sbjct: 405 KLDREALYVKLLNSTLASMQGWTEKRL 431 >At2g41540.2 68415.m05134 NAD-dependent glycerol-3-phosphate dehydrogenase family protein weak similarity to SP|P46919 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) {Bacillus subtilis}; contains Pfam profile PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase Length = 462 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/38 (28%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 323 PLKFPAEINEGIWGGEAVVKGFQKRDDRR--RRVPHYW 430 PLK + E +W + VV G + R + YW Sbjct: 145 PLKVVTNLQEAVWDADIVVNGLPSTETREVFEEISKYW 182 >At2g41540.1 68415.m05133 NAD-dependent glycerol-3-phosphate dehydrogenase family protein weak similarity to SP|P46919 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) {Bacillus subtilis}; contains Pfam profile PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase Length = 462 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/38 (28%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 323 PLKFPAEINEGIWGGEAVVKGFQKRDDRR--RRVPHYW 430 PLK + E +W + VV G + R + YW Sbjct: 145 PLKVVTNLQEAVWDADIVVNGLPSTETREVFEEISKYW 182 >At5g60920.1 68418.m07642 phytochelatin synthetase, putative / COBRA cell expansion protein COB, putative similar to phytochelatin synthetase GI:29570314; similar to GB:AAK56072; identified in Roudier, et al, Plant Phys. (2002) 130:538-548 (PMID:12376623); identical to cDNA putative phytochelatin synthetase GI:3559804; contains Pfam profile PF04833: Phytochelatin synthetase-like conserved region Length = 456 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -3 Query: 484 EMSIENFRSYYSSLQYWHPVVRYPASSIITLLETFNHSFSSPY 356 +++I NF +Y + W+ V ++P IT + +FN+ +PY Sbjct: 317 KITITNF-NYRLNYTQWNLVAQHPNLDNITQIFSFNYKSLTPY 358 >At3g46610.1 68416.m05060 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 665 Score = 27.1 bits (57), Expect = 7.5 Identities = 21/68 (30%), Positives = 33/68 (48%) Frame = +3 Query: 180 QSFHLLIKNFGVSGRY*SQQLYISFLKKGSGNATN*LVKLIRYKIFLFLLNSPLKSMRGY 359 Q F +IK FG R + +LK+ + +I +F++ NS L +MRG+ Sbjct: 147 QVFCAMIKGFGKDKRLKPAVAVVDWLKRKKSESGG----VIGPNLFIY--NSLLGAMRGF 200 Query: 360 GEEKLWLK 383 GE + LK Sbjct: 201 GEAEKILK 208 >At3g18860.2 68416.m02396 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to phospholipase a-2-activating protein SP:P27612 from [Mus musculus] Length = 760 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 445 LQYWHPVVRYPASSIITLLETFNHSFS 365 LQ W P + +PA+ I+ +L +H S Sbjct: 564 LQAWPPAMMFPATDIVRMLVLHHHGAS 590 >At3g18860.1 68416.m02395 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to phospholipase a-2-activating protein SP:P27612 from [Mus musculus] Length = 760 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 445 LQYWHPVVRYPASSIITLLETFNHSFS 365 LQ W P + +PA+ I+ +L +H S Sbjct: 564 LQAWPPAMMFPATDIVRMLVLHHHGAS 590 >At3g12380.1 68416.m01543 actin/actin-like family protein similar to SP|P53946 Actin-like protein ARP5 {Saccharomyces cerevisiae}; contains Pfam profile PF00022: Actin Length = 724 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 254 PQEGKWKRDELTGETYPIQNIPIPLKFPAEINE 352 P E + D L E YP+ N+P + P ++ + Sbjct: 371 PAEYEENPDSLNNEKYPLMNVPDDILTPEQLKD 403 >At1g48880.1 68414.m05476 hypothetical protein Length = 485 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = -3 Query: 502 IRYSY*EMSIENFRSYY---SSLQYWHPVVRYPASSIITLLETFNHSFSSPYPLIDFSGE 332 +R+S ++E +RS + WH R ++ + +L+ NH +SS LI +G+ Sbjct: 230 VRFSSYNFTVEFYRSVFLVQPGRLRWHAPKRVKSTLKLDVLDVINHEWSSADFLIFNTGQ 289 Query: 331 F 329 + Sbjct: 290 W 290 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,180,589 Number of Sequences: 28952 Number of extensions: 237519 Number of successful extensions: 701 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -