BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30522 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53393| Best HMM Match : RVT_1 (HMM E-Value=5.8e-30) 37 0.011 SB_57243| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 36 0.020 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 36 0.020 SB_52191| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 36 0.020 SB_40877| Best HMM Match : RVT_1 (HMM E-Value=2.9e-28) 36 0.020 SB_34233| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 36 0.020 SB_8612| Best HMM Match : RVT_1 (HMM E-Value=2.1e-32) 36 0.020 SB_411| Best HMM Match : RVT_1 (HMM E-Value=2.5e-29) 36 0.020 SB_55535| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 36 0.020 SB_53290| Best HMM Match : RVT_1 (HMM E-Value=3.8e-31) 36 0.020 SB_45153| Best HMM Match : rve (HMM E-Value=0) 36 0.020 SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) 36 0.020 SB_38701| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 36 0.020 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_28151| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 36 0.020 SB_28069| Best HMM Match : RVT_1 (HMM E-Value=1.8e-28) 36 0.020 SB_27987| Best HMM Match : RVT_1 (HMM E-Value=4.8e-32) 36 0.020 SB_27381| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_24280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_23220| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) 36 0.020 SB_20781| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 36 0.020 SB_16795| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35) 36 0.020 SB_4558| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 36 0.020 SB_3870| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_3083| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 36 0.020 SB_46264| Best HMM Match : rve (HMM E-Value=1.9e-16) 35 0.035 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_51937| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 34 0.060 SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) 34 0.060 SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39) 34 0.060 SB_39101| Best HMM Match : RVT_1 (HMM E-Value=2.4e-38) 34 0.060 SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38) 34 0.060 SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 34 0.060 SB_9368| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_155| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 34 0.060 SB_46071| Best HMM Match : RVP (HMM E-Value=3e-05) 34 0.060 SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37) 34 0.060 SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 34 0.060 SB_23675| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 34 0.060 SB_19158| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 34 0.060 SB_15324| Best HMM Match : RVP (HMM E-Value=8.1e-05) 34 0.060 SB_10983| Best HMM Match : RVP (HMM E-Value=3.8e-05) 34 0.060 SB_56534| Best HMM Match : RVT_1 (HMM E-Value=5.5e-28) 34 0.080 SB_49535| Best HMM Match : RVT_1 (HMM E-Value=5.1e-32) 34 0.080 SB_41052| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_32381| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 34 0.080 SB_25533| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 34 0.080 SB_24596| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_21600| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 34 0.080 SB_18449| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 34 0.080 SB_52054| Best HMM Match : zf-CCHC (HMM E-Value=6.6e-05) 34 0.080 SB_48461| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 34 0.080 SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_24581| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 34 0.080 SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_4864| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 34 0.080 SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_56918| Best HMM Match : zf-CCHC (HMM E-Value=7.4e-07) 33 0.14 SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_21743| Best HMM Match : rve (HMM E-Value=4e-17) 33 0.14 SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.18 SB_56107| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 33 0.18 SB_51823| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 33 0.18 SB_42176| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 33 0.18 SB_27878| Best HMM Match : zf-CCHC (HMM E-Value=0.00046) 33 0.18 SB_21117| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 33 0.18 SB_15656| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_39547| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_34655| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 33 0.18 SB_28775| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 33 0.18 SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18) 33 0.18 SB_13663| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 33 0.18 SB_10363| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_15012| Best HMM Match : zf-CCHC (HMM E-Value=1.1e-05) 32 0.24 SB_13669| Best HMM Match : zf-CCHC (HMM E-Value=1.3e-06) 32 0.24 SB_43121| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) 31 0.43 SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_697| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) 31 0.43 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 31 0.43 SB_59232| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 31 0.56 SB_52251| Best HMM Match : rve (HMM E-Value=1.1e-34) 31 0.56 SB_40370| Best HMM Match : rve (HMM E-Value=1.3e-37) 31 0.56 SB_34077| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 31 0.56 SB_15198| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_9047| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19) 31 0.56 SB_4255| Best HMM Match : rve (HMM E-Value=1.4e-38) 31 0.56 SB_59611| Best HMM Match : zf-CCHC (HMM E-Value=7.7e-05) 31 0.74 SB_59531| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.74 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 31 0.74 SB_53795| Best HMM Match : rve (HMM E-Value=5.9e-15) 31 0.74 SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) 31 0.74 SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 31 0.74 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_39683| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.74 SB_25683| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.74 SB_6083| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.74 SB_5734| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 31 0.74 SB_42776| Best HMM Match : rve (HMM E-Value=1.4e-24) 31 0.74 SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36) 31 0.74 SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.74 SB_25715| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.74 SB_24493| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.74 SB_24279| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_23207| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.74 SB_22197| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.74 SB_16302| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 31 0.74 SB_15963| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.74 SB_15389| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.74 SB_14793| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_421| Best HMM Match : RVT_1 (HMM E-Value=2.4e-18) 31 0.74 SB_58082| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_4461| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_22256| Best HMM Match : zf-CCHC (HMM E-Value=0.0025) 30 1.3 SB_49662| Best HMM Match : Bromodomain (HMM E-Value=9.8e-38) 29 1.7 SB_31048| Best HMM Match : zf-CCHC (HMM E-Value=5.5e-05) 29 1.7 SB_25619| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_23070| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_16016| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) 29 1.7 SB_13976| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_6778| Best HMM Match : fn3 (HMM E-Value=0.13) 29 1.7 SB_23747| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_23039| Best HMM Match : rve (HMM E-Value=2.8e-20) 29 1.7 SB_18880| Best HMM Match : zf-CCHC (HMM E-Value=0.00013) 29 1.7 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_16404| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) 29 1.7 SB_31801| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_25586| Best HMM Match : RVT_1 (HMM E-Value=2.3e-18) 29 2.3 SB_24434| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 29 3.0 SB_19840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_47578| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_37538| Best HMM Match : zf-CCHC (HMM E-Value=0.0011) 29 3.0 SB_50210| Best HMM Match : I-set (HMM E-Value=0.11) 28 4.0 SB_39421| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) 28 4.0 SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 28 4.0 SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30) 28 4.0 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 28 4.0 SB_35375| Best HMM Match : RVT_1 (HMM E-Value=0.00074) 28 4.0 SB_33425| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 28 4.0 SB_45977| Best HMM Match : MBT (HMM E-Value=0) 28 5.3 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_19905| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_2550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_53824| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_45323| Best HMM Match : rve (HMM E-Value=5.3e-31) 27 6.9 SB_41121| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 27 6.9 SB_24051| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_15066| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 27 6.9 SB_14798| Best HMM Match : zf-CCHC (HMM E-Value=0.00014) 27 6.9 SB_4685| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_3642| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 27 6.9 SB_3304| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 27 6.9 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) 27 6.9 SB_36113| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 27 6.9 SB_32933| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 27 6.9 SB_23479| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_15517| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 27 6.9 SB_5379| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 27 6.9 SB_57096| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_51396| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) 27 9.2 SB_47769| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) 27 9.2 SB_40176| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) 27 9.2 SB_33262| Best HMM Match : DOMON (HMM E-Value=2.7e-28) 27 9.2 SB_8485| Best HMM Match : zf-CCHC (HMM E-Value=0.018) 27 9.2 SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_46270| Best HMM Match : rve (HMM E-Value=1.2e-09) 27 9.2 SB_45402| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) 27 9.2 SB_44931| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) 27 9.2 SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_489| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) 27 9.2 >SB_53393| Best HMM Match : RVT_1 (HMM E-Value=5.8e-30) Length = 1246 Score = 36.7 bits (81), Expect = 0.011 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ GH +K C AK+A C CG+ GH Sbjct: 244 TSCHWCGKKAGHVKKDCPAKDAKCRNCGKTGH 275 >SB_57243| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 341 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 92 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 119 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 384 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 411 >SB_52191| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 529 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 358 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 385 >SB_40877| Best HMM Match : RVT_1 (HMM E-Value=2.9e-28) Length = 734 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 209 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 236 >SB_34233| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 216 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 92 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 119 >SB_8612| Best HMM Match : RVT_1 (HMM E-Value=2.1e-32) Length = 621 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 36 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 63 >SB_411| Best HMM Match : RVT_1 (HMM E-Value=2.5e-29) Length = 730 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 92 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 119 >SB_55535| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 378 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 36 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 63 >SB_53290| Best HMM Match : RVT_1 (HMM E-Value=3.8e-31) Length = 1090 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 209 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 236 >SB_45153| Best HMM Match : rve (HMM E-Value=0) Length = 2264 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 209 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 236 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 1129 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 1156 >SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) Length = 1845 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 194 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 221 >SB_38701| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 314 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 209 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 236 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 209 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 236 >SB_28151| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 410 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 92 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 119 >SB_28069| Best HMM Match : RVT_1 (HMM E-Value=1.8e-28) Length = 593 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 152 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 179 >SB_27987| Best HMM Match : RVT_1 (HMM E-Value=4.8e-32) Length = 779 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 209 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 236 >SB_27381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1392 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 193 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 220 >SB_24280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 209 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 236 >SB_23220| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) Length = 1597 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 209 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 236 >SB_20781| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 391 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 36 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 63 >SB_16795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 972 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 209 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 236 >SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1520 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 430 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 457 >SB_4558| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 207 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 36 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 63 >SB_3870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 275 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 302 >SB_3083| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 295 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEATC C + GH Sbjct: 140 CYRCGKNHHPSK-CRFKEATCHYCKKKGH 167 >SB_46264| Best HMM Match : rve (HMM E-Value=1.9e-16) Length = 979 Score = 35.1 bits (77), Expect = 0.035 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP C A A C +CG+ GH Sbjct: 214 CGRCGRGPHPRDECNATNADCHKCGKRGH 242 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 34.7 bits (76), Expect = 0.046 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = -2 Query: 491 CNKCQQYGHPEKFC---RAKEATCGRCGEDGH 405 C+KC + GH + C R + TC +CGE GH Sbjct: 382 CHKCGEVGHFARECPTGRGQSDTCHKCGETGH 413 >SB_51937| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 151 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 107 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 137 >SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) Length = 1311 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 107 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 137 >SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39) Length = 1510 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 209 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 239 >SB_39101| Best HMM Match : RVT_1 (HMM E-Value=2.4e-38) Length = 856 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 352 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 382 >SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38) Length = 1425 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 878 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 908 >SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 794 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 344 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 374 >SB_9368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 424 TACHRCGSAEHDGKSCKYKKYKCDNCGKMGH 454 >SB_155| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 296 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 209 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 239 >SB_46071| Best HMM Match : RVP (HMM E-Value=3e-05) Length = 403 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 209 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 239 >SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37) Length = 1122 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 225 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 255 >SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 495 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 525 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 548 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 578 >SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 1750 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 187 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 217 >SB_23675| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 342 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 182 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 212 >SB_19158| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 369 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 209 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 239 >SB_15324| Best HMM Match : RVP (HMM E-Value=8.1e-05) Length = 415 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 46 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 76 >SB_10983| Best HMM Match : RVP (HMM E-Value=3.8e-05) Length = 717 Score = 34.3 bits (75), Expect = 0.060 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C++C H K C+ K+ C CG+ GH Sbjct: 248 TACHRCGSAEHDGKSCKYKKYKCDNCGKVGH 278 >SB_56534| Best HMM Match : RVT_1 (HMM E-Value=5.5e-28) Length = 1052 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 236 TSCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 267 >SB_49535| Best HMM Match : RVT_1 (HMM E-Value=5.1e-32) Length = 991 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 92 TSCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 123 >SB_41052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 251 TSCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 282 >SB_32381| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) Length = 282 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 238 TSCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 269 >SB_25533| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 426 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K C KEATC C + GH Sbjct: 43 CYRCGKNHHPSK-CHFKEATCHYCKKKGH 70 >SB_24596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K C KEATC C + GH Sbjct: 158 CYRCGKNHHPSK-CHFKEATCHYCKKKGH 185 >SB_21600| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) Length = 216 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 93 TSCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 124 >SB_18449| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 624 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K C KEATC C + GH Sbjct: 209 CYRCGKNHHPSK-CHFKEATCHYCKKKGH 236 >SB_52054| Best HMM Match : zf-CCHC (HMM E-Value=6.6e-05) Length = 437 Score = 33.9 bits (74), Expect = 0.080 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGH--PEKFCRAKEATCGRCGEDGH 405 CN+C GH E C+A+ C +CG+ GH Sbjct: 187 CNRCGMEGHFSKEPECKARGRMCNKCGKIGH 217 >SB_48461| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 327 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP CR KEATC C + GH Sbjct: 92 CYRCGK-NHPPSKCRFKEATCHYCKKKGH 119 >SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1963 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 979 TSCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 1010 >SB_24581| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) Length = 469 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 237 TSCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 268 >SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 761 TSCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 792 >SB_4864| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) Length = 426 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 251 TSCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 282 >SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3038 Score = 33.5 bits (73), Expect = 0.11 Identities = 24/97 (24%), Positives = 34/97 (35%), Gaps = 1/97 (1%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGHRMEXXXXXXXXXXXXXXXXXXAMHPTAS 321 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 2165 TPCHWCGKKADHVKKDCPAKDAKCRNCGKTGHYAVVCRSNKQVHEVNREEEGSYQEDYYL 2224 Query: 320 RDCPARRHAEERFLNQVEYGY*APTSYWPNQSGWCRG 210 DC +E+ L V +P S + WC G Sbjct: 2225 DDCYFMGEVKEKLLAMVRQKVISPVS---EPTDWCSG 2258 >SB_56918| Best HMM Match : zf-CCHC (HMM E-Value=7.4e-07) Length = 517 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 112 TPCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 143 >SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1165 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 248 TPCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 279 >SB_21743| Best HMM Match : rve (HMM E-Value=4e-17) Length = 865 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 251 TPCHWCGKKADHVKKDCPAKDAKCRNCGKTGH 282 >SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 2353 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 126 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 155 >SB_56107| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 508 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 135 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 164 >SB_51823| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 382 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 232 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 261 >SB_42176| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 612 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 206 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 235 >SB_27878| Best HMM Match : zf-CCHC (HMM E-Value=0.00046) Length = 338 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 89 CHRCNRQGHKAADCRCSKNHQCEKCGKIGH 118 >SB_21117| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 438 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 186 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 215 >SB_15656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 56 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 85 >SB_39547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 206 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 235 >SB_34655| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 297 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 206 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 235 >SB_28775| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 295 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 204 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 233 >SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18) Length = 1138 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 157 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 186 >SB_13663| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 356 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 206 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 235 >SB_10363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR +K C +CG+ GH Sbjct: 86 CHRCNKQGHKAADCRCSKNHQCEKCGKIGH 115 >SB_15012| Best HMM Match : zf-CCHC (HMM E-Value=1.1e-05) Length = 410 Score = 32.3 bits (70), Expect = 0.24 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C Q GHP C + C RCG GH Sbjct: 152 CGYCHQVGHPISTCPVR-GRCFRCGAAGH 179 >SB_13669| Best HMM Match : zf-CCHC (HMM E-Value=1.3e-06) Length = 385 Score = 32.3 bits (70), Expect = 0.24 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 497 TCCNKC-QQYGHPEKFCRAKEATCGRCGEDGH 405 T C+ C ++ H +K C AK+A C CG+ GH Sbjct: 251 TPCHWCGKKADHVKKDCPAKDAKCLNCGKTGH 282 >SB_43121| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) Length = 1037 Score = 31.5 bits (68), Expect = 0.43 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEAT C + GH Sbjct: 209 CYRCGKNHHPSK-CRFKEATFHYCKKKGH 236 >SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2306 Score = 31.5 bits (68), Expect = 0.43 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHPEKF--CRAKEATCGRCGEDGH 405 C +C GH K C+A+ C +CGE GH Sbjct: 1528 CYRCGMEGHFSKDPECKARGRMCNKCGEIGH 1558 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGR 423 CNKC + GH KF +AK T R Sbjct: 1550 CNKCGEIGHFAKFAKAKSKTAER 1572 >SB_697| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) Length = 603 Score = 31.5 bits (68), Expect = 0.43 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C + HP K CR KEAT C + GH Sbjct: 92 CYRCGKNHHPSK-CRFKEATFHYCKKKGH 119 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 31.5 bits (68), Expect = 0.43 Identities = 23/66 (34%), Positives = 28/66 (42%), Gaps = 7/66 (10%) Frame = -1 Query: 465 PGEILPGQGGHLWPMWRGWPP-------NGGL*GSLRVLCDLPAIPSRGYAPDGLARLSG 307 PG P GG+ P G+ P GG+ L + PA P +GYAP G Sbjct: 186 PGGYYPPPGGYQQPPPGGYAPPPYVPQEGGGIPPQNHPLTNYPAPPPQGYAPPP-GGYPG 244 Query: 306 APACGG 289 AP GG Sbjct: 245 APPAGG 250 >SB_59232| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 356 Score = 31.1 bits (67), Expect = 0.56 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR ++ C +CG+ GH Sbjct: 206 CHRCNKQGHKAADCRCSQNHQCEKCGKIGH 235 >SB_52251| Best HMM Match : rve (HMM E-Value=1.1e-34) Length = 863 Score = 31.1 bits (67), Expect = 0.56 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR ++ C +CG+ GH Sbjct: 198 CHRCNKQGHKAADCRCSQNHQCEKCGKIGH 227 >SB_40370| Best HMM Match : rve (HMM E-Value=1.3e-37) Length = 1393 Score = 31.1 bits (67), Expect = 0.56 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR ++ C +CG+ GH Sbjct: 263 CHRCNKQGHKAADCRCSQNHQCEKCGKIGH 292 >SB_34077| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 403 Score = 31.1 bits (67), Expect = 0.56 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR ++ C +CG+ GH Sbjct: 126 CHRCNKQGHKAADCRCSQNHQCEKCGKIGH 155 >SB_15198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 31.1 bits (67), Expect = 0.56 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR ++ C +CG+ GH Sbjct: 206 CHRCNKQGHKAADCRCSQNHQCEKCGKIGH 235 >SB_9047| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19) Length = 1116 Score = 31.1 bits (67), Expect = 0.56 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR ++ C +CG+ GH Sbjct: 164 CHRCNKQGHKAADCRCSQNHQCEKCGKIGH 193 >SB_4255| Best HMM Match : rve (HMM E-Value=1.4e-38) Length = 899 Score = 31.1 bits (67), Expect = 0.56 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR ++ C +CG+ GH Sbjct: 206 CHRCNKQGHKAADCRCSQNHQCEKCGKIGH 235 >SB_59611| Best HMM Match : zf-CCHC (HMM E-Value=7.7e-05) Length = 314 Score = 30.7 bits (66), Expect = 0.74 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 467 HPEKFCRAKEATCGRCGEDGH 405 H +K C AK+A C CG+ GH Sbjct: 3 HVKKDCPAKDAKCRNCGKTGH 23 >SB_59531| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 323 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 8 CFFCGNKKHPRPKCPALEAICNKCQKKGH 36 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 28 CNKCQKKGHFAKVCKGK 44 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 213 CFFCGNKKHPRPKCPALEAICNKCQKKGH 241 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_53795| Best HMM Match : rve (HMM E-Value=5.9e-15) Length = 615 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 118 CFFCGNKKHPRPKCPALEAICNKCQKKGH 146 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 138 CNKCQKKGHFAKVCKGK 154 >SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) Length = 1075 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 121 CFFCGNKKHPRPKCPALEAICNKCQKKGH 149 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 141 CNKCQKKGHFAKVCKGK 157 >SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 998 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 213 CFFCGNKKHPRPKCPALEAICNKCQKKGH 241 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 30.7 bits (66), Expect = 0.74 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 491 CNKCQQYGHPEKFCR-AKEATCGRCGEDGH 405 C++C + GH CR ++ C +CG+ GH Sbjct: 1023 CHRCNKQGHKAADCRCSQNHHCEKCGKIGH 1052 >SB_39683| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 579 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 177 CFFCGNKKHPRPKCPALEAICNKCQKKGH 205 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 197 CNKCQKKGHFAKVCKGK 213 >SB_25683| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 249 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 56 CFFCGNKKHPRPKCPALEAICNKCQKKGH 84 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 76 CNKCQKKGHFAKVCKGK 92 >SB_6083| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 176 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 56 CFFCGNKKHPRPKCPALEAICNKCQKKGH 84 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 76 CNKCQKKGHFAKVCKGK 92 >SB_5734| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 508 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 8 CFFCGNKKHPRPKCPALEAICNKCQKKGH 36 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 28 CNKCQKKGHFAKVCKGK 44 >SB_42776| Best HMM Match : rve (HMM E-Value=1.4e-24) Length = 627 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 45 CFFCGNKKHPRPKCPALEAICNKCQKKGH 73 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 65 CNKCQKKGHFAKVCKGK 81 >SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 1048 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 213 CFFCGNKKHPRPKCPALEAICNKCQKKGH 241 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 397 CFFCGNKKHPRPKCPALEAICNKCQKKGH 425 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 417 CNKCQKKGHFAKVCKGK 433 >SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 538 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 334 CFFCGNKKHPRPKCPALEAICNKCQKKGH 362 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 354 CNKCQKKGHFAKVCKGK 370 >SB_25715| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 270 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 8 CFFCGNKKHPRPKCPALEAICNKCQKKGH 36 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 28 CNKCQKKGHFAKVCKGK 44 >SB_24493| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 176 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 56 CFFCGNKKHPRPKCPALEAICNKCQKKGH 84 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 76 CNKCQKKGHFAKVCKGK 92 >SB_24279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 213 CFFCGNKKHPRPKCPALEAICNKCQKKGH 241 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_23207| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 260 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 56 CFFCGNKKHPRPKCPALEAICNKCQKKGH 84 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 76 CNKCQKKGHFAKVCKGK 92 >SB_22197| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 528 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 213 CFFCGNKKHPRPKCPALEAICNKCQKKGH 241 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_16302| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 870 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 213 CFFCGNKKHPRPKCPALEAICNKCQKKGH 241 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_15963| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 434 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 198 CFFCGNKKHPRPKCPALEAICNKCQKKGH 226 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 218 CNKCQKKGHFAKVCKGK 234 >SB_15389| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 462 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 333 CFFCGNKKHPRPKCPALEAICNKCQKKGH 361 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 353 CNKCQKKGHFAKVCKGK 369 >SB_14793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 821 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 497 CFFCGNKKHPRPKCPALEAICNKCQKKGH 525 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 517 CNKCQKKGHFAKVCKGK 533 >SB_421| Best HMM Match : RVT_1 (HMM E-Value=2.4e-18) Length = 1046 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C HP C A EA C +C + GH Sbjct: 558 CFFCGNKKHPRPKCPALEAICNKCQKKGH 586 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 578 CNKCQKKGHFAKVCKGK 594 >SB_58082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 30.3 bits (65), Expect = 0.98 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C C H K C AK +C CG+ GH Sbjct: 179 CYFCGGPLHNRKDCPAKNCSCNNCGKGGH 207 >SB_4461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 747 Score = 30.3 bits (65), Expect = 0.98 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 467 HPEKFCRAKEATCGRCGEDGH 405 HP K CR KEATC C GH Sbjct: 216 HPSK-CRFKEATCHYCKRKGH 235 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.9 bits (64), Expect = 1.3 Identities = 26/74 (35%), Positives = 33/74 (44%), Gaps = 3/74 (4%) Frame = +2 Query: 203 RRILCTT---QIDLANTKSGPNIHTRPDLGSAPPHAGAPDSRARPSGA*PRDGIAGRSHS 373 R I TT Q+ ++ + SGP+I ++P APP A A P A P G Sbjct: 135 RHIAMTTRKAQVQVSASSSGPSIASQPPQPPAPPAAPFMAPAAPP--APPPPGAPA---- 188 Query: 374 TRRLPYRPPFGGHP 415 P PPFGG P Sbjct: 189 ---APPAPPFGGPP 199 >SB_22256| Best HMM Match : zf-CCHC (HMM E-Value=0.0025) Length = 238 Score = 29.9 bits (64), Expect = 1.3 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 494 CCNKCQQYGHPEKFCRAKE 438 CC C + GHP++ CR+K+ Sbjct: 18 CCFSCLKRGHPQRECRSKK 36 >SB_49662| Best HMM Match : Bromodomain (HMM E-Value=9.8e-38) Length = 1301 Score = 29.5 bits (63), Expect = 1.7 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 8/71 (11%) Frame = +2 Query: 254 PNIHTRPDLGSAPPHAGAPDSRARPSGA*--------PRDGIAGRSHSTRRLPYRPPFGG 409 P +T P L AP G P P G P DG+AG + +R+P P G Sbjct: 586 PPGYTPPHLTRAP--MGGPQGIGYPQGVQGRMPYPRPPGDGVAGPAQGMQRMPGPMPMSG 643 Query: 410 HPLHIGHRWPP 442 H+G + PP Sbjct: 644 ---HLGPQGPP 651 >SB_31048| Best HMM Match : zf-CCHC (HMM E-Value=5.5e-05) Length = 601 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGH--PEKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 121 CYRCGRKGHRSSDKVCKALGKKCNNCGVVGH 151 >SB_25619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1038 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGH--PEKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 285 CYRCGRKGHRSSDKVCKALGKKCNNCGVVGH 315 >SB_23070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGH--PEKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 479 CYRCGRKGHRSSDKVCKALGKKCNNCGVVGH 509 >SB_16016| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) Length = 890 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGHRME 396 C+KC + GH + CR+K T ED H E Sbjct: 88 CDKCTKVGHFDAVCRSKPNTRVSQVEDAHEGE 119 >SB_13976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 763 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 342 LATESPAGRTARGGCLTGLHSVAILSTSATGGLLGPA 452 L S AG A G C TG ++V + +A GG+ G A Sbjct: 15 LIASSSAGPLAYGICQTGCNAVWVTCVAAAGGVAGVA 51 >SB_6778| Best HMM Match : fn3 (HMM E-Value=0.13) Length = 464 Score = 29.5 bits (63), Expect = 1.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 419 HIGHRWPPWP 448 H+ HRWPPWP Sbjct: 358 HMPHRWPPWP 367 >SB_23747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGH--PEKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 199 CYRCGRKGHRSSDKVCKALGKKCNNCGVVGH 229 >SB_23039| Best HMM Match : rve (HMM E-Value=2.8e-20) Length = 984 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGH--PEKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 543 CYRCGRKGHRSSDKVCKALGKKCNNCGVVGH 573 >SB_18880| Best HMM Match : zf-CCHC (HMM E-Value=0.00013) Length = 388 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGH--PEKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 197 CYRCGRKGHRSSDKVCKALGKKCNNCGVVGH 227 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 29.5 bits (63), Expect = 1.7 Identities = 23/66 (34%), Positives = 28/66 (42%), Gaps = 3/66 (4%) Frame = +2 Query: 326 PSGA*PRDGIAGRSHSTRRLPY-RPPFGGHPLHIGHRWPP--WPGKISPGDHIADTYCSR 496 P+ + P+ G H + P PP GGHP H PP +PG PG H A Sbjct: 582 PTPSYPQPGTYPPPHPSGGYPQPSPPHGGHP----HHPPPTGYPGGY-PGTHTAPPAGGY 636 Query: 497 SPGQSP 514 GQ P Sbjct: 637 PTGQHP 642 >SB_16404| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) Length = 765 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGHRME 396 C+KC + GH + CR+K T ED H E Sbjct: 70 CDKCTKVGHFDAVCRSKPNTRVSQVEDAHEGE 101 >SB_31801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C C H C+ K+ CG C + GH Sbjct: 215 TLCFGCGSDKHLADACKHKDTICGYCSKPGH 245 >SB_25586| Best HMM Match : RVT_1 (HMM E-Value=2.3e-18) Length = 802 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK 441 CNKCQ+ GH K C+ K Sbjct: 125 CNKCQKKGHFAKVCKGK 141 >SB_24434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1194 Score = 29.1 bits (62), Expect = 2.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 280 RKRSSACRRAGQSREAVGCIASRR 351 R R+ C++ G R+A+GC+ R Sbjct: 652 RMRNRTCQKPGSPRQAIGCVGKER 675 >SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1957 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGH--PEKFCRAKEATCGRCGEDGH 405 C C + GH + C AK +C CG GH Sbjct: 932 CFNCNRTGHIARDPVCPAKSQSCNSCGIKGH 962 >SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 1131 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -2 Query: 500 VTCCNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 V C +C + GH +K C+A C CG GH Sbjct: 275 VVVCFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 308 >SB_19840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +2 Query: 266 TRPDLGSAPPHAGAPDSRARPSGA*PRDGIAGRSHSTR 379 TR D + PHA D + S A DG++ SH+TR Sbjct: 92 TRDDGMPSDPHATRDDGMSSDSHATRGDGVSSDSHATR 129 >SB_47578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 744 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 10/42 (23%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAK----------EATCGRCGEDGHRME 396 C C + H + CRA+ TC RCGE+GH E Sbjct: 650 CTICGRTNHVARLCRARYDIYGRRVHPRDTCFRCGEEGHWAE 691 >SB_37538| Best HMM Match : zf-CCHC (HMM E-Value=0.0011) Length = 215 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGHRME 396 C+KC + GH CR+K T ED H E Sbjct: 95 CDKCTKVGHIAAVCRSKPNTRVSQVEDAHEGE 126 >SB_50210| Best HMM Match : I-set (HMM E-Value=0.11) Length = 348 Score = 28.3 bits (60), Expect = 4.0 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Frame = +3 Query: 24 TVICVLLRWCRTAQG-STLLRIYTPALGCAPHWARNPTM--EYCSCTRTISRPRSRAMEG 194 +V + +++C A+ S +L++Y C A P M +YC CTR +S+ + Sbjct: 59 SVPAMSVKYCECARNVSQVLQVYAQ---CQSSIASVPAMSVKYCECTRNVSQVLRVCAQC 115 Query: 195 SSLVAS 212 S +AS Sbjct: 116 QSSIAS 121 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +3 Query: 24 TVICVLLRWCRTAQG-STLLRIYTPALGCAPHWARNPTMEYCSCTRTISRPRSRAMEGSS 200 +V + +++C+ A+ S +L++Y R +++YC C R +S+ + S Sbjct: 121 SVPAMSVKYCKCARNVSQVLQVYAQCQSSIAS-VRTMSVKYCECARNVSQVLRVCAQCQS 179 Query: 201 LVAS 212 +AS Sbjct: 180 SIAS 183 >SB_39421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1810 Score = 28.3 bits (60), Expect = 4.0 Identities = 31/94 (32%), Positives = 40/94 (42%), Gaps = 2/94 (2%) Frame = +2 Query: 236 ANTKSGPNIHTRPDLGSAPPHAGAPDSRARPSG-A*PRDGIAGRSHSTRRLPYRPPFGGH 412 A+ + P + P ++P H G+P A P A PR I+ + +R P F Sbjct: 1450 ASQSTTPGDRSSPGHLASPGHVGSPRYEASPGHLASPRYFISRGQSADQRYP-ESDF-AV 1507 Query: 413 PLHIGHRWPPWPG-KISPGDHIADTYCSRSPGQS 511 P H G R P SPG H AD S PG S Sbjct: 1508 PGHSGSRSAENPRFSTSPG-HSADLDHSTIPGYS 1540 >SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) Length = 1287 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/31 (38%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHPEK--FCRAKEATCGRCGEDGH 405 C C + GH + C AK C CG GH Sbjct: 1227 CFNCNRTGHIARNPVCPAKSQNCNSCGIKGH 1257 >SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 1198 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGHRME 396 C+KC + GH CR+K T ED H E Sbjct: 23 CDKCTKVGHFAAVCRSKPNTRVSQVEDAHEGE 54 >SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30) Length = 1191 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGHRME 396 C+KC + GH CR+K T ED H E Sbjct: 237 CDKCTKVGHFAAVCRSKPNTRVSQVEDAHEGE 268 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 28.3 bits (60), Expect = 4.0 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Frame = +3 Query: 24 TVICVLLRWCRTAQG-STLLRIYTPALGCAPHWARNPTM--EYCSCTRTISRPRSRAMEG 194 +V + +++C A+ S +L++Y C A P M +YC CTR +S+ + Sbjct: 1605 SVPAMSVKYCECARNVSQVLQVYAQ---CQSSIASVPAMSVKYCECTRNVSQVLRVCAQC 1661 Query: 195 SSLVAS 212 S +AS Sbjct: 1662 QSSIAS 1667 >SB_35375| Best HMM Match : RVT_1 (HMM E-Value=0.00074) Length = 996 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C H CRA EA C +CG+ H Sbjct: 45 CGRCGAK-HSTGNCRAYEAECHKCGKRNH 72 >SB_33425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 957 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 134 GRVPSPMWSTPQGGCVYPQ*GAPLRGSAPP*QHTYNG 24 G +P +P G C P+ +PL G +PP + + NG Sbjct: 98 GECSTPEKCSPHGECYAPEEYSPLGGYSPPEECSPNG 134 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 28.3 bits (60), Expect = 4.0 Identities = 21/75 (28%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = +1 Query: 4 PTPQCALPLYVCC*GGAEPRRGAPYCGYTHPPWGVLHIGLGTRPWNIVPVQEQ-YPGRDP 180 P P +P V G A P P PP G +P+ P +Q YP + P Sbjct: 119 PPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPP 178 Query: 181 VQWRVAPSSHPLHHP 225 Q P P +P Sbjct: 179 PQAYPQPGYPPQGYP 193 >SB_45977| Best HMM Match : MBT (HMM E-Value=0) Length = 1198 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 512 DFVRVTCCNKCQQYGHPEKFC 450 D +V CC C YG P+ FC Sbjct: 343 DESQVLCCEVCGVYGLPQDFC 363 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEA---TCGRCGEDGH 405 C+KC + GH + C ++ C +C E GH Sbjct: 466 CHKCNEEGHFARECPNADSGGNKCFKCNESGH 497 >SB_19905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGHRME 396 C+KC + GH CR+K T ED H E Sbjct: 187 CDKCTKVGHFVAVCRSKPNTRVSQVEDAHEGE 218 >SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGHRME 396 C+KC + GH CR+K T ED H E Sbjct: 187 CDKCTKVGHFAVVCRSKPNTRVSQVEDAHEGE 218 >SB_2550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 447 GQGGHLWPMWRGWPPNGGL*GSL 379 G+ + WRGWP N L G+L Sbjct: 397 GRNEEYFVQWRGWPDNNALEGAL 419 >SB_53824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 740 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 197 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 227 >SB_45323| Best HMM Match : rve (HMM E-Value=5.3e-31) Length = 577 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -2 Query: 497 TCCNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 T C +C H CR K+ CG + GH Sbjct: 164 TLCFRCGSDKHLADACRHKDTICGYFSKPGH 194 >SB_41121| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 550 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 122 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 152 >SB_24051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 889 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 28 LYVCC*GGAEPRRGAPYCGYTH 93 L + C GA RR PYC YT+ Sbjct: 544 LAIDCRSGAASRRPFPYCAYTY 565 >SB_15066| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 338 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 252 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 282 >SB_14798| Best HMM Match : zf-CCHC (HMM E-Value=0.00014) Length = 377 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 133 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 163 >SB_4685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 76 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 106 >SB_3642| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 283 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 197 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 227 >SB_3304| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 285 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 6 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 36 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 1210 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 1240 >SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) Length = 2110 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -3 Query: 223 GGAEDATRELPSIARDLGLDIVLVQEQYSMVGFLAQCGAHPKAGVYIRN 77 G D + P + LG+DIV+ Q+ Y L + HP AG + N Sbjct: 1069 GKIVDIEKLTPLLKSGLGIDIVVPQKVYRSAEKLEREKTHPLAGDLLIN 1117 >SB_36113| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 283 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 197 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 227 >SB_32933| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 92 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 6 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 36 >SB_23479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 6 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 36 >SB_15517| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 799 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 197 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 227 >SB_5379| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 285 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 491 CNKCQQYGHP--EKFCRAKEATCGRCGEDGH 405 C +C + GH +K C+A C CG GH Sbjct: 6 CFRCGKRGHVARDKSCKAVGKKCNDCGVVGH 36 >SB_57096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 27.1 bits (57), Expect = 9.2 Identities = 28/86 (32%), Positives = 35/86 (40%), Gaps = 2/86 (2%) Frame = +2 Query: 191 G*LPRRILCTTQIDLANTKSGPNIHTRPDLGSAPPHAGAPDSRARPSGA*PRDGIAGRSH 370 G LP R L + ++ SG R L S +G SR PSG P + R Sbjct: 161 GRLPSRRLPSRRLPSRRLPSGCLPSRRGQLPSRRLPSGRLPSRRLPSGWLPSRRLPSRRL 220 Query: 371 STRRLPYRP-PFGGHPL-HIGHRWPP 442 + RLP R P G P + RW P Sbjct: 221 PSGRLPSRRLPSGRLPSGRLPSRWLP 246 >SB_51396| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) Length = 357 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C H + C K+ C +CG+ GH Sbjct: 105 CYRCGN-SHDPQSCWFKDQNCYKCGKKGH 132 >SB_47769| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) Length = 616 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C H + C K+ C +CG+ GH Sbjct: 235 CYRCGN-SHDPQSCWFKDQNCYKCGKKGH 262 >SB_40176| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) Length = 310 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C H + C K+ C +CG+ GH Sbjct: 58 CYRCGN-SHDPQSCWFKDQNCYKCGKKGH 85 >SB_33262| Best HMM Match : DOMON (HMM E-Value=2.7e-28) Length = 595 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +3 Query: 315 VARGRRVHSLATESPAGRTARGGCLTGLHSVAILSTSATGG 437 VA G RV S + GR ARGG + VA+ A+GG Sbjct: 502 VASGGRVASGGRVASGGRVARGGRVASGGRVAMGGRVASGG 542 >SB_8485| Best HMM Match : zf-CCHC (HMM E-Value=0.018) Length = 257 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -2 Query: 485 KCQQYG--HPEKFCRAKEATCGRCGEDGH 405 KC+ G H + C A ATC RC E H Sbjct: 210 KCRFCGLQHDQGNCTAYNATCHRCKEKNH 238 >SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1741 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +3 Query: 120 ARNPTMEYCSCTRTISRPRSRAMEGSSLVASSAPPRLIWPIRS 248 A +P +CT +IS R + GS++V APP + P+R+ Sbjct: 1160 ATSPGHVLFTCTPSISGDR-HVLNGSAVVHVKAPPVVSLPVRN 1201 >SB_46270| Best HMM Match : rve (HMM E-Value=1.2e-09) Length = 657 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 447 GQGGHLWPMWRGWPPNGGL*GSL 379 G+ + WRGWP N + G+L Sbjct: 396 GRNEEYFVQWRGWPDNNAIQGAL 418 >SB_45402| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) Length = 388 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C H + C K+ C +CG+ GH Sbjct: 235 CYRCGN-SHDPQSCWFKDQNCYKCGKKGH 262 >SB_44931| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) Length = 388 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C H + C K+ C +CG+ GH Sbjct: 235 CYRCGN-SHDPQSCWFKDQNCYKCGKKGH 262 >SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1089 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C H + C K+ C +CG+ GH Sbjct: 356 CYRCGN-SHDPQSCWFKDQNCYKCGKKGH 383 >SB_489| Best HMM Match : zf-CCHC (HMM E-Value=0.00034) Length = 329 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 491 CNKCQQYGHPEKFCRAKEATCGRCGEDGH 405 C +C H + C K+ C +CG+ GH Sbjct: 274 CYRCGN-SHDPQSCWFKDQNCYKCGKKGH 301 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,261,354 Number of Sequences: 59808 Number of extensions: 551713 Number of successful extensions: 2144 Number of sequences better than 10.0: 179 Number of HSP's better than 10.0 without gapping: 1681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2131 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -