BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30521 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_46682| Best HMM Match : Fibrinogen_C (HMM E-Value=0.022) 31 0.43 SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) 30 0.98 SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8) 29 1.7 SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) 29 2.3 SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06) 29 2.3 SB_30499| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_25844| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_43300| Best HMM Match : C2 (HMM E-Value=7.2e-05) 28 4.0 SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 28 4.0 SB_3330| Best HMM Match : RBM1CTR (HMM E-Value=0.62) 28 4.0 SB_49967| Best HMM Match : RBM1CTR (HMM E-Value=1.4) 28 5.3 SB_8029| Best HMM Match : Mucin (HMM E-Value=8.6) 28 5.3 SB_54983| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_25952| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 27 6.9 SB_57201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 31.9 bits (69), Expect = 0.32 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 368 ENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGF 514 EN L + GK + + + I G+YEY GP + RV AD GF Sbjct: 154 ENSTLTQNCGKW-GISSSSVEINRWGYYEYTGPKRMYARVIVWADHLGF 201 >SB_46682| Best HMM Match : Fibrinogen_C (HMM E-Value=0.022) Length = 395 Score = 31.5 bits (68), Expect = 0.43 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 359 YETENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGF 514 + ++N L + GK + + + I G+YEY GP + RV AD GF Sbjct: 315 FTSKNSTLTQNCGKW-GISSSSVEINRWGYYEYTGPKRMYARVIVWADHLGF 365 >SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 30.3 bits (65), Expect = 0.98 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +3 Query: 345 ATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTVSPTE*TTLLTKTVS 515 +TTT + P T + + + + T AP T R+ +T T AP+ S T +T + S Sbjct: 75 STTTTSAPSTS-TPRTGSTTTTSAPSTSTPRTGSTTTTSAPSTSTTSNSTTRAPSTS 130 Score = 28.7 bits (61), Expect = 3.0 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +3 Query: 348 TTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTVSPTE*TTLLTKTVS 515 TT+ + P T + + + + T AP T R+ +T T AP+ S T +T + S Sbjct: 15 TTSTSTPSTS-TPRAGSTTNTSAPSTSTPRTGSTTTTSAPSTSTTSNSTTRAPSTS 69 Score = 27.9 bits (59), Expect = 5.3 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +3 Query: 345 ATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTVS-PTE*TTLLTKTVS 515 +TTT + P T + + S T AP T R+ +T T AP+ S P +T T S Sbjct: 46 STTTTSAPSTSTT----SNSTTRAPSTSTPRAGSTTTTSAPSTSTPRTGSTTTTSAPS 99 >SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) Length = 509 Score = 30.3 bits (65), Expect = 0.98 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = +3 Query: 339 PKATTTCTRPRTRF--SLKKPARSRTLAPKTKASRSRDSTNTLAPTVSPTE*TTLL 500 P ATTT T+P T + P + T P + ++ +T T T +PT LL Sbjct: 139 PPATTTPTKPTTTTPPATTTPTKPTTTTPPATTTPTKSTTTTPPATTTPTTRPLLL 194 >SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8) Length = 541 Score = 29.5 bits (63), Expect = 1.7 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = +3 Query: 339 PKATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAP 467 PK T TRP+TR + R +T PKTK S+S+ T T P Sbjct: 270 PK-TRPKTRPKTRPKTRPKTRPKT-RPKTK-SKSKSKTKTATP 309 >SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) Length = 516 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/61 (26%), Positives = 25/61 (40%) Frame = +2 Query: 233 SKVVTPTYVASKVVPPSGAGYDYKYGIIRYDNDVAPEGYHYLYETENKILAEEAGKVENV 412 + ++ P V +K P G DY Y + D +A YH L E +E++ Sbjct: 183 ANIIAPISVVNKF--PPGTVVDYAYNVFYQDRKIAHTPYHALTVGERDCYNARRDMLEHL 240 Query: 413 G 415 G Sbjct: 241 G 241 >SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06) Length = 425 Score = 29.1 bits (62), Expect = 2.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 259 NVCGCDHLAGNVCGCDWHGNGRL 191 N GC+ GN GC++ G+ R+ Sbjct: 382 NTMGCEFQGGNTMGCEFQGDSRI 404 >SB_30499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 81 PVLLEVPEEPTSEPRRTSANTLVMLTRDPA 170 PVL +P S PRR S +LTR PA Sbjct: 111 PVLNHTVVQPPSSPRRCSVQLEQILTRSPA 140 >SB_25844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -3 Query: 268 LAGNVCGCDHLAGNVCGCDWHGNGRLHDGQGNNAGSLVSITKV 140 L GN CG L GN CG +GN GN +G+ + V Sbjct: 238 LYGNKCGTS-LYGNKCGTSLYGNKSGTSLYGNKSGNPPDVVAV 279 >SB_43300| Best HMM Match : C2 (HMM E-Value=7.2e-05) Length = 304 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 81 PVLLEVPEEPTSEPRRTSANTLVMLTRDPA 170 PVL +P S PRR S +LTR PA Sbjct: 86 PVLNHTVVQPPSSPRRCSVQLEQILTRSPA 115 >SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) Length = 877 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = -3 Query: 253 CG-CD---HLAGNVCGCDWHGNGRL-HDGQGN 173 CG CD AG V CDW G+G L D +GN Sbjct: 667 CGPCDVAVDSAGRVIACDWSGDGVLVFDSRGN 698 >SB_3330| Best HMM Match : RBM1CTR (HMM E-Value=0.62) Length = 546 Score = 28.3 bits (60), Expect = 4.0 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +3 Query: 351 TTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTV 473 T T R R+ + P RS L P+ +ASRSRD APT+ Sbjct: 262 TELTERRKRYFVS-PLRSSCLWPRGRASRSRD--GACAPTM 299 >SB_49967| Best HMM Match : RBM1CTR (HMM E-Value=1.4) Length = 334 Score = 27.9 bits (59), Expect = 5.3 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = +3 Query: 348 TTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTVSPTE 485 T + R ++RF P RS P +ASRSRD APT+ P E Sbjct: 262 TESTERRKSRFV--SPLRSSCRWPLGRASRSRD--GACAPTMPPPE 303 >SB_8029| Best HMM Match : Mucin (HMM E-Value=8.6) Length = 325 Score = 27.9 bits (59), Expect = 5.3 Identities = 20/55 (36%), Positives = 25/55 (45%) Frame = +3 Query: 345 ATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTVSPTE*TTLLTKT 509 A+TT P+T + K P PKT +R + ST T T T T TKT Sbjct: 161 ASTTTETPKTTKAPKTPIT----IPKTTTNRPQTSTITAKITTESTTATQATTKT 211 >SB_54983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 366 PRTRFSLKKPARSRTLAPKTKASRSRD 446 P+T+ KP +R + KTK SR++D Sbjct: 25 PKTKTKTSKPQAARQASRKTKTSRTQD 51 >SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1205 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +2 Query: 311 IIRYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFYEYVG 463 I+RYD + P Y E++I E K +++ G+ GF+E +G Sbjct: 491 IVRYDRNKVPSLYQLFKFIESRIEFELRTKHKSIFGYALGVIFAGFFEGIG 541 >SB_25952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.5 bits (58), Expect = 6.9 Identities = 20/59 (33%), Positives = 24/59 (40%) Frame = +3 Query: 339 PKATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTVSPTE*TTLLTKTVS 515 P + TCT T + P S T + S ST + PT S T TT T T S Sbjct: 100 PTPSYTCTTSYTSTTSYTPTTSYTPTTSYTCTTSYTSTTSYTPTTSYTP-TTSYTLTTS 157 >SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 354 TCTRPRTRFSLKKPARSRTLAPKTKASRSRDS 449 TC R + SL P+ S + +P A+R RDS Sbjct: 44 TCPHCRAKASLPSPSPSPSPSPSQGATRERDS 75 >SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 344 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 366 PRTRFSLKKPARSRTLAPKTKASRSRDSTNTLA 464 P+T+ + KPAR R +PK K S+ +D +A Sbjct: 289 PKTKST--KPARPRQASPKAKTSKPQDQDKQVA 319 >SB_57201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 Query: 408 TLAPKTKASRSRDSTNTL 461 T+APKTK SR+ +TNT+ Sbjct: 11 TMAPKTKCSRATMATNTV 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,248,706 Number of Sequences: 59808 Number of extensions: 219307 Number of successful extensions: 819 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -