BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30513 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22160| Best HMM Match : Arc (HMM E-Value=7.5) 31 0.43 SB_45462| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_22160| Best HMM Match : Arc (HMM E-Value=7.5) Length = 246 Score = 31.5 bits (68), Expect = 0.43 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 9/70 (12%) Frame = +2 Query: 266 QTFKEKGFLI---QTQQLQSAEGATYCKFRQLR------KFTRYLFRSWKDYLPGELEEK 418 Q+ K GFL ++ + +A ATY KFR R +F +YL R W ++ + E Sbjct: 59 QSLKRSGFLYDLTESSVIPTATSATYRKFRLKRNGMKKTEFFKYLRRKWCSFITKSVPEF 118 Query: 419 TTENKEVRDT 448 E++E ++ Sbjct: 119 WLESEETPES 128 >SB_45462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -2 Query: 464 NSSPRRCP*PLYSRLSFL-PIPRANSPSNSGISTL 363 +SSP PLY+ L+ + +P+A +PSNS I L Sbjct: 16 HSSPNYTTCPLYNLLTPVNDMPQAKTPSNSNIGML 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,091,901 Number of Sequences: 59808 Number of extensions: 229163 Number of successful extensions: 596 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 596 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -