BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30507 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 2.6 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 24 3.5 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 3.5 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 24 3.5 AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding pr... 24 3.5 AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-b... 24 3.5 AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding pr... 24 3.5 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 23 4.6 AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding pr... 23 4.6 AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-b... 23 4.6 DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormo... 23 6.1 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 6.1 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 23 8.1 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.2 bits (50), Expect = 2.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 215 TVVVIANSYSALTLCSPRTSLV*SCSTRPFTRRLTMERL 331 TVVV+++ +SA PR S+ S +RP + R+ Sbjct: 763 TVVVVSDLHSAAARTPPRQSIGYSLVSRPSSASSNQSRV 801 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 23.8 bits (49), Expect = 3.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 158 PPVQWESVCRTSAW 199 PP W SV R SAW Sbjct: 159 PPSNWVSVFRGSAW 172 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.8 bits (49), Expect = 3.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 327 ASGLPAGEEGHHPRHQGRQGCRPAVRIGRRMHH 425 ASG P G GHH H G A HH Sbjct: 697 ASGSPYGGGGHHLSHH-HGGAAAATGHHHHQHH 728 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 3.5 Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +2 Query: 140 SSPLTNPPVQWESVCRTSAWRTQRR-----TVVVIANSYSALTLCSPRTS 274 ++P+ P W + T+ W Q R T V +S + T +P T+ Sbjct: 155 TTPIWTDPTTWSAPTTTTTWSDQPRPPTTTTTTVWTDSTATTTTHAPTTT 204 >AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding protein AgamOBP3 protein. Length = 153 Score = 23.8 bits (49), Expect = 3.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 70 YPTPELQEELKKIAQAIVA 126 YP PEL E++K + A VA Sbjct: 38 YPPPELLEKMKPMHDACVA 56 >AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-binding protein OBPjj15 protein. Length = 153 Score = 23.8 bits (49), Expect = 3.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 70 YPTPELQEELKKIAQAIVA 126 YP PEL E++K + A VA Sbjct: 38 YPPPELLEKMKPMHDACVA 56 >AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding protein protein. Length = 153 Score = 23.8 bits (49), Expect = 3.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 70 YPTPELQEELKKIAQAIVA 126 YP PEL E++K + A VA Sbjct: 38 YPPPELLEKMKPMHDACVA 56 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 414 RMHHPGSGRPRPALRPVQEGRLPLRQVALR 503 RM PG P P V E L++V +R Sbjct: 328 RMSRPGEPYPHPCRPTVDEKNKQLQEVEMR 357 >AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding protein AgamOBP23 protein. Length = 131 Score = 23.4 bits (48), Expect = 4.6 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +1 Query: 433 LDDLAQRCAQYKKDGCHFA 489 +D++ ++C + K+D C A Sbjct: 99 IDEMLEKCGEQKEDACETA 117 >AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-binding protein OBPjj14 protein. Length = 131 Score = 23.4 bits (48), Expect = 4.6 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +1 Query: 433 LDDLAQRCAQYKKDGCHFA 489 +D++ ++C + K+D C A Sbjct: 99 IDEMLEKCGEQKEDACETA 117 >DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormone II protein. Length = 113 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +2 Query: 149 LTNPPVQWESVCRTSAWRTQRRTVVVIANSYSALTLCSPRTSL 277 + + PV + C ++ WR + + LTLC R+ L Sbjct: 46 MPDSPVSGVAEC-SAIWRPVNNLCAAVTKNIQHLTLCETRSLL 87 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 229 DNDDGSPLCSPRRCPANAFPLYRWIRQRRGYP 134 D G+P+C NA L +W + G+P Sbjct: 307 DKMAGNPICVQIPWDRNAEALAKWASGQTGFP 338 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 430 GLDDLAQRCAQYKKDG 477 G+D+L R Q+K+DG Sbjct: 197 GIDELKTRLLQHKEDG 212 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 540,351 Number of Sequences: 2352 Number of extensions: 11984 Number of successful extensions: 46 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -